Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

General negative regulator of transcription subunit 2

 
Known also as: cell division cycle protein 36

Known abbreviations: NOT2, CDC36, DNA19

FUNCTION:

Acts as component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover. NOT2 is required for the integrity of the complex. The NOT protein subcomplex negatively regulates the basal and activated transcription of many genes. Preferentially affects TC-type TATA element-dependent transcription. Could directly or indirectly inhibit component(s) of the general transcription machinery.

SUBUNIT:

Forms a NOT protein complex that comprises NOT1, NOT2, NOT3, NOT4 and NOT5. Subunit of the 1.0 MDa CCR4-NOT core complex that contains CCR4, CAF1, NOT1, NOT2, NOT3, NOT4, NOT5, CAF40 and CAF130. In the complex interacts with NOT1 and NOT5. The core complex probably is part of a less characterized 1.9 MDa CCR4-NOT complex.

SUBCELLULAR LOCATION:

Cytoplasm. Nucleus.




This protein can be a part of a given complexes: Activities in which General negative regulator of transcription subunit 2 is involved: Pathways in which General negative regulator of transcription subunit 2 is involved:

NCBI GI number(s): 115930
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P06100 P06100
BRENDA - -
KEGG sce:YDL165W sce:YDL165W
PFAM: - P06100 (Link - using uniprot id)
InterPro: - P06100 (Link - using uniprot id)
CATH: - -
SCOP: - -


Protein sequence:
MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDH
RVLDTFQSPWAETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQND
QQRVALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD
PMMEPIVSADGLSERGSYVFFDPQRWEKCQRDFLLFYNAIM

General negative regulator of transcription subunit 2 (Saccharomyces cerevisiae) is product of expression of CDC36 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
NOT1(CDC39), NOT2(CDC36), NOT3, and NOT4 encode a global-negative regulator of transcription that differentially affects TATA-element utilization. Collart MA, Struhl K Genes Dev 1994-03-01 (8) 7926748
Ccr4p is the catalytic subunit of a Ccr4p/Pop2p/Notp mRNA deadenylase complex in Saccharomyces cerevisiae. Tucker M, Staples RR, Valencia-Sanchez MA, Muhlrad D, Parker R EMBO J 2002-03-15 (21) 11889048
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature 1997-05-01 (387) 9169867
Purification and characterization of the 1.0 MDa CCR4-NOT complex identifies two novel components of the complex. Chen J, Rappsilber J, Chiang YC, Russell P, Mann M, Denis CL J Mol Biol 2001-12-07 (314) 11733989
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
The NOT proteins are part of the CCR4 transcriptional complex and affect gene expression both positively and negatively. Liu HY, Badarinarayana V, Audino DC, Rappsilber J, Mann M, Denis CL EMBO J 1998-01-16 (17) 9463387
The CCR4 and CAF1 proteins of the CCR4-NOT complex are physically and functionally separated from NOT2, NOT4, and NOT5. Bai Y, Salvadore C, Chiang YC, Collart MA, Liu HY, Denis CL Mol Cell Biol 1999-10-01 (19) 10490603
Characterization of mutations in NOT2 indicates that it plays an important role in maintaining the integrity of the CCR4-NOT complex. Russell P, Benson JD, Denis CL J Mol Biol 2002-09-06 (322) 12215412
Nucleotide sequence of the yeast cell division cycle start genes CDC28, CDC36, CDC37, and CDC39, and a structural analysis of the predicted products. Ferguson J, Ho JY, Peterson TA, Reed SI Nucleic Acids Res 1986-08-26 (14) 3018676
The nucleotide sequence of the DNA ligase gene (CDC9) from Saccharomyces cerevisiae: a gene which is cell-cycle regulated and induced in response to DNA damage. Barker DG, White JH, Johnston LH Nucleic Acids Res 1985-12-09 (13) 3909103



Add your own comment!


There are no comments yet.

Entry added on: 2010-04-12 22:38:15, by a user: kaja

Welcome stranger! Click here to login or here to register.