Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

PAB-dependent poly(A)-specific ribonuclease subunit PAN2

 
Known also as: PAB1P-dependent poly(A)-nuclease

Known abbreviations: PAN2, YGL094C

FUNCTION:

  • one of the two subunits of PAN - the second one is Pan3p  (PMID: 9774670, 15169912)
  • required for Poly (A) exoribonuclease activity (PAN), plays an important role in the posttranscriptional maturation of mRNA poly(A) tails. Trimming of the poly(A) tail to a specific length by PAN is required for efficient Pabp-dependent mRNA export to the cytoplasm  (PMID: 15169912, 17595167, 15630021)
  • catalytic activity relevant to PAN function (this activity is activated upon recruitment to the mRNA) (PMID: 9774670)
  • interacts with Pbp1p (protein that appears to negatively regulate PAN) in case when dissociation of Pbp1p from Pab1p does not occur prior to PAN binding (PMID: 15169912)

REACTION:

poly(A) RNA + H2O -> 5'-AMP (BRENDA)

CATALYTIC ACTIVITY:

Exonucleolytic cleavage of poly(A) to 5'-AMP.

CELLULAR LOCALIZATION:
 
Cytoplasm (PMID: 9774670, 15894541)

SUBUNIT STRUCTURE:

The PAN deadenylation complex is a heterodimer of a catalytic subunit PAN2 and a regulatory subunit PAN3.

ENZYME REGULATION:

Positively regulated by the regulatory subunit PAN3. Negatively regulated by PAB1-binding protein PBP1. Inhibited under stress conditions. Inhibition of deadenylation under stress increases mRNA stability, which may be a mechanism to retain the majority of the cytoplasmic pool of mRNAs for later reuse and recovery from stress.

OTHER:
  • Model of maturation of mRNA poly(A) tails (PMID: 15169912)
  • homologous to the RNase T family (PMID: 15169912, 9774670)
  • Model for Poly(A) tail lenght control in yeast (PMID: 9774670)

 




Activities in which PAB-dependent poly(A)-specific ribonuclease subunit PAN2 is involved: Pathways in which PAB-dependent poly(A)-specific ribonuclease subunit PAN2 is involved:

NCBI GI number(s): 1709565
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P53010 P53010
BRENDA - -
KEGG sce:YGL094C sce:YGL094C
PFAM: PF00929
PF00929
InterPro: IPR006055
IPR013520
IPR001394
IPR012337
IPR015943
IPR017986
IPR006055
IPR013520
IPR001394
IPR012337
IPR015943
IPR017986
CATH: - -
SCOP: - -


Protein sequence:
MNNWQHFFNNPVDLSEHLKKPYFRFDNRDKEITAISFDEKANLIWSGDSY
GCISSYDPTFQLYTRYRGHIGGNSVKDILSHRDGILSISEDSLHFANRRG
VTKLNLTSIDIAAFSELNTMCYSPHSLKNNIYCGGDNTNWGIASIDLNRG
CLDSLLNYSSKVKLMCSNNKVLSIGRQTGTVDLLDPTSNRTIKSFNAHSA
SISAMDLRDNTLVTVGKSKRFYNLYADPFVNVYDLRTMRQLPPVSFSKGT
TMGSGGADFVQLHPLLPTVMIVASSSGSFDFIDLSNPTLRTQYVHPCQSI
KKLCLSPNGDVLGILEADNHLDTWRRSSNNMGMFTNTPEMLAYPDYFNDI
TSDGPISVDDETYPLSSVGMPYYLDKLLSAWPPVVFKSEGTIPQLTGKSP
LPSSGKLKSNLAVISSQNEKLSTQEFPLLRYDRTKYGMRNAIPDYVCLRD
IRKQITSGLETSDIQTYTSINKYEVPPAYSRLPLTSGRFGTDNFDFTPFN
NTEYSGLDPDVDNHYTNAIIQLYRFIPEMFNFVVGCLKDENFETTLLTDL
GYLFDMMERSHGKICSSSNFQASLKSLTDKRQLENGEPQEHLEEYLESLC
IRESIEDFNSSESIKRNMPQKFNRFLLSQLIKEEAQTVNHNITLNQCFGL
ETEIRTECSCDHYDTTVKLLPSLSISGINKTVIKQLNKKSNGQNILPYIE
YAMKNVTQKNSICPTCGKTETITQECTVKNLPSVLSLELSLLDTEFSNIR
SSKNWLTSEFYGSIIKNKAVLRSTASELKGTSHIFKYELNGYVAKITDNN
NETRLVTYVKKYNPKENCFKWLMFNDYLVVEITEEEALKMTYPWKTPEII
IYCDAEELRKPFFSVDTYSINYDILFRDYFANGIRDTARREYKLLTHDEA
PKSGTLVAIDAEFVSLQSELCEIDHQGIRSIIRPKRTALARISIIRGEEG
ELYGVPFVDDYVVNTNHIEDYLTRYSGILPGDLDPEKSTKRLVRRNVVYR
KVWLLMQLGCVFVGHGLNNDFKHININVPRNQIRDTAIYFLQGKRYLSLR
YLAYVLLGMNIQEGNHDSIEDAHTALILYKKYLHLKEKAIFEKVLNSVYE
EGRAHNFKVPETSKG

PAB-dependent poly(A)-specific ribonuclease subunit PAN2 (Saccharomyces cerevisiae) is product of expression of PAN2 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
Positive and negative regulation of poly(A) nuclease. Mangus DA, Evans MC, Agrin NS, Smith M, Gongidi P, Jacobson A Mol Cell Biol 2004-06-01 (24) 15169912
Poly(A) nuclease interacts with the C-terminal domain of polyadenylate-binding protein domain from poly(A)-binding protein. Siddiqui N, Mangus DA, Chang TC, Palermino JM, Shyu AB, Gehring K J Biol Chem 2007-08-24 (282) 17595167
Yeast poly(A)-binding protein, Pab1, and PAN, a poly(A) nuclease complex recruited by Pab1, connect mRNA biogenesis to export. Dunn EF, Hammell CM, Hodge CA, Cole CN Genes Dev 2005-02-01 (19) 15630021
Poly(A) tail length control in Saccharomyces cerevisiae occurs by message-specific deadenylation. Brown CE, Sachs AB Mol Cell Biol 1998-11-01 (18) 9774670
Yeast mRNA Poly(A) tail length control can be reconstituted in vitro in the absence of Pab1p-dependent Poly(A) nuclease activity. Dheur S, Nykamp KR, Viphakone N, Swanson MS, Minvielle-Sebastia L J Biol Chem 2005-07-01 (280) 15894541
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K Nature 1997-05-01 (387) 9169869
PAN3 encodes a subunit of the Pab1p-dependent poly(A) nuclease in Saccharomyces cerevisiae. Brown CE, Tarun SZ Jr, Boeck R, Sachs AB Mol Cell Biol 1996-10-01 (16) 8816488
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII. Rieger M, Bruckner M, Schafer M, Muller-Auer S Yeast 1997-09-15 (13) 9290212
Posttranscriptional regulation of the RAD5 DNA repair gene by the Dun1 kinase and the Pan2-Pan3 poly(A)-nuclease complex contributes to survival of replication blocks. Hammet A, Pike BL, Heierhorst J J Biol Chem 2002-06-21 (277) 11953437
The yeast Pan2 protein is required for poly(A)-binding protein-stimulated poly(A)-nuclease activity. Boeck R, Tarun S Jr, Rieger M, Deardorff JA, Muller-Auer S, Sachs AB J Biol Chem 1996-02-05 (271) 8550599
Translation initiation requires the PAB-dependent poly(A) ribonuclease in yeast. Sachs AB, Deardorff JA Cell 1992-09-18 (70) 1339314
Identification of factors regulating poly(A) tail synthesis and maturation. Mangus DA, Smith MM, McSweeney JM, Jacobson A Mol Cell Biol 2004-05-01 (24) 15121841
Translation-independent inhibition of mRNA deadenylation during stress in Saccharomyces cerevisiae. Hilgers V, Teixeira D, Parker R RNA 2006-10-01 (12) 16940550



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-11-23 09:48:08
Edited by a user: kaja
Edited content: Changed kegg and gene.

Welcome stranger! Click here to login or here to register.