|
Known also as: PAB1P-dependent poly(A)-nuclease
Known abbreviations: PAN3, YKL025C, ECM35
FUNCTION:
-
required for Poly (A) exoribonuclease activity - PAN plays an important role in the posttranscriptional maturation of mRNA poly(A) tails( one of the two subunits of PAN - the second one is Pan2p) (PMID: 9774670, 15169912)
-
positive activator of PAN activity (PMID: 15169912)
-
interaction with Pab1p (poly(A)-binding protein required for stimulation (via Pan3p) or inhibition (via Pbp1p) of poly(A) tail trimming) (PMID: 15169912, 17595167, 15630021)
CELLULAR LOCALIZATION:
Cytoplasm (PMID: 9774670, 15894541)
SUBUNIT STRUCTURE:
The PAN deadenylation complex is a heterodimer of a catalytic subunit PAN2 and a regulatory subunit PAN3. PAN3 interacts with PAB1, conferring substrate-specificity of the enzyme complex.
OTHER:
Pan3p contains PAN-2 motif (PMID: 17595167)
|
Activities in which PAB-dependent poly(A)-specific ribonuclease subunit PAN3 is involved:
Pathways in which PAB-dependent poly(A)-specific ribonuclease subunit PAN3 is involved:
Links to other databases:
Protein sequence:
MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTATTINDVPPPI
DVGEATTPTMTSVPKFNAKVSASFTPMTVGSDSLTTVTNTTSAATNATGN
IAMAATSATASTVNPMINPIVNSSLVNNNNNNSNISISIPTTASSSNYDP
FNAPIFTPSSTSSIHTNANAHSFPFPSIANSGGININATDDNSNNMSMAN
NVPPPMQPPPIESSNLKYPRIYPPPHSLLQYHLYAPEQPSSLKSLLKPNE
RSADQLFIPNNIREDLTKKNLSILQVFPSSGKVIPSIVQDYFNLVPLNFN
NNDFLNKTTLFKVFSNYDGKAYVLKRLPNIDKSMNPNKISKIYQIWSKIN
CTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDYHFVNFPKFPITNN
YLWIYLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCNFMD
LLFNDDTDTVVSSGGSTIEGQQQLDYKYLGELLFNLSINIENSNNNTAPK
EYRLEEITPQSIDDMRQIDDKFKDVLKYLISDNGDSKKSIHDLTSHFYDK
MFMVLESSQTYTEYMESVLSRELENGRLFRLVNKLNCIFGRIESRIDINW
SESGTKFPIILFYDYVFHQVDSNGKPIMDLTHVLRCLNKLDAGIQEKLML
VTPDELNCIIISYKELKDLIESTFRSITQ
|
PAB-dependent poly(A)-specific ribonuclease subunit PAN3 (Saccharomyces cerevisiae) is product of expression of
PAN3
gene.
References:
Title |
Authors |
Journal
| Publication date (Issue)
| PubMed ID
|
Global analysis of protein localization in budding yeast. |
Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK |
Nature
|
2003-10-16 (425) |
14562095 |
Positive and negative regulation of poly(A) nuclease. |
Mangus DA, Evans MC, Agrin NS, Smith M, Gongidi P, Jacobson A |
Mol Cell Biol
|
2004-06-01 (24) |
15169912 |
Poly(A) nuclease interacts with the C-terminal domain of polyadenylate-binding protein domain from poly(A)-binding protein. |
Siddiqui N, Mangus DA, Chang TC, Palermino JM, Shyu AB, Gehring K |
J Biol Chem
|
2007-08-24 (282) |
17595167 |
Yeast poly(A)-binding protein, Pab1, and PAN, a poly(A) nuclease complex recruited by Pab1, connect mRNA biogenesis to export. |
Dunn EF, Hammell CM, Hodge CA, Cole CN |
Genes Dev
|
2005-02-01 (19) |
15630021 |
Poly(A) tail length control in Saccharomyces cerevisiae occurs by message-specific deadenylation. |
Brown CE, Sachs AB |
Mol Cell Biol
|
1998-11-01 (18) |
9774670 |
Yeast mRNA Poly(A) tail length control can be reconstituted in vitro in the absence of Pab1p-dependent Poly(A) nuclease activity. |
Dheur S, Nykamp KR, Viphakone N, Swanson MS, Minvielle-Sebastia L |
J Biol Chem
|
2005-07-01 (280) |
15894541 |
Complete DNA sequence of yeast chromosome XI. |
Dujon B, Alexandraki D, Andre B, Ansorge W, Baladron V, Ballesta JP, Banrevi A, Bolle PA, Bolotin-Fukuhara M, Bossier P, et al. |
Nature
|
1994-06-02 (369) |
8196765 |
PAN3 encodes a subunit of the Pab1p-dependent poly(A) nuclease in Saccharomyces cerevisiae. |
Brown CE, Tarun SZ Jr, Boeck R, Sachs AB |
Mol Cell Biol
|
1996-10-01 (16) |
8816488 |
Global analysis of protein expression in yeast. |
Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS |
Nature
|
2003-10-16 (425) |
14562106 |
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. |
Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP |
J Proteome Res
|
2007-03-01 (6) |
17330950 |
A multidimensional chromatography technology for in-depth phosphoproteome analysis. |
Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H |
Mol Cell Proteomics
|
2008-07-01 (7) |
18407956 |
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. |
Smolka MB, Albuquerque CP, Chen SH, Zhou H |
Proc Natl Acad Sci U S A
|
2007-06-19 (104) |
17563356 |
Posttranscriptional regulation of the RAD5 DNA repair gene by the Dun1 kinase and the Pan2-Pan3 poly(A)-nuclease complex contributes to survival of replication blocks. |
Hammet A, Pike BL, Heierhorst J |
J Biol Chem
|
2002-06-21 (277) |
11953437 |
Combining chemical genetics and proteomics to identify protein kinase substrates. |
Dephoure N, Howson RW, Blethrow JD, Shokat KM, O'Shea EK |
Proc Natl Acad Sci U S A
|
2005-12-13 (102) |
16330754 |
Add your own comment!
There are no comments yet.
Last modification of this entry: Sept. 25, 2012.
|