Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

PAB-dependent poly(A)-specific ribonuclease subunit PAN3

 
Known also as: PAB1P-dependent poly(A)-nuclease

Known abbreviations: PAN3, YKL025C, ECM35

 

FUNCTION:
  • required for Poly (A) exoribonuclease activity - PAN plays an important role in the posttranscriptional maturation of mRNA poly(A) tails( one of the two subunits of PAN - the second one is Pan2p) (PMID: 9774670, 15169912)
  • positive activator of PAN activity (PMID: 15169912)
  • interaction with Pab1p (poly(A)-binding protein required for stimulation (via Pan3p) or inhibition (via Pbp1p) of poly(A) tail trimming) (PMID: 15169912, 17595167, 15630021)
CELLULAR LOCALIZATION:
 
Cytoplasm (PMID: 9774670, 15894541)
 
SUBUNIT STRUCTURE:
 
The PAN deadenylation complex is a heterodimer of a catalytic subunit PAN2 and a regulatory subunit PAN3. PAN3 interacts with PAB1, conferring substrate-specificity of the enzyme complex.
 
OTHER:
 
Pan3p contains PAN-2 motif (PMID: 17595167)

 




Activities in which PAB-dependent poly(A)-specific ribonuclease subunit PAN3 is involved: Pathways in which PAB-dependent poly(A)-specific ribonuclease subunit PAN3 is involved:

NCBI GI number(s): 6322827
296146349
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P36102 P36102
BRENDA - -
KEGG sce:YKL025C sce:YKL025C
PFAM: - P36102 (Link - using uniprot id)
InterPro: IPR011009
IPR000719
IPR000571
IPR011009
IPR000719
IPR000571
CATH: - -
SCOP: - -


Protein sequence:
MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTATTINDVPPPI
DVGEATTPTMTSVPKFNAKVSASFTPMTVGSDSLTTVTNTTSAATNATGN
IAMAATSATASTVNPMINPIVNSSLVNNNNNNSNISISIPTTASSSNYDP
FNAPIFTPSSTSSIHTNANAHSFPFPSIANSGGININATDDNSNNMSMAN
NVPPPMQPPPIESSNLKYPRIYPPPHSLLQYHLYAPEQPSSLKSLLKPNE
RSADQLFIPNNIREDLTKKNLSILQVFPSSGKVIPSIVQDYFNLVPLNFN
NNDFLNKTTLFKVFSNYDGKAYVLKRLPNIDKSMNPNKISKIYQIWSKIN
CTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDYHFVNFPKFPITNN
YLWIYLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCNFMD
LLFNDDTDTVVSSGGSTIEGQQQLDYKYLGELLFNLSINIENSNNNTAPK
EYRLEEITPQSIDDMRQIDDKFKDVLKYLISDNGDSKKSIHDLTSHFYDK
MFMVLESSQTYTEYMESVLSRELENGRLFRLVNKLNCIFGRIESRIDINW
SESGTKFPIILFYDYVFHQVDSNGKPIMDLTHVLRCLNKLDAGIQEKLML
VTPDELNCIIISYKELKDLIESTFRSITQ

PAB-dependent poly(A)-specific ribonuclease subunit PAN3 (Saccharomyces cerevisiae) is product of expression of PAN3 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
Positive and negative regulation of poly(A) nuclease. Mangus DA, Evans MC, Agrin NS, Smith M, Gongidi P, Jacobson A Mol Cell Biol 2004-06-01 (24) 15169912
Poly(A) nuclease interacts with the C-terminal domain of polyadenylate-binding protein domain from poly(A)-binding protein. Siddiqui N, Mangus DA, Chang TC, Palermino JM, Shyu AB, Gehring K J Biol Chem 2007-08-24 (282) 17595167
Yeast poly(A)-binding protein, Pab1, and PAN, a poly(A) nuclease complex recruited by Pab1, connect mRNA biogenesis to export. Dunn EF, Hammell CM, Hodge CA, Cole CN Genes Dev 2005-02-01 (19) 15630021
Poly(A) tail length control in Saccharomyces cerevisiae occurs by message-specific deadenylation. Brown CE, Sachs AB Mol Cell Biol 1998-11-01 (18) 9774670
Yeast mRNA Poly(A) tail length control can be reconstituted in vitro in the absence of Pab1p-dependent Poly(A) nuclease activity. Dheur S, Nykamp KR, Viphakone N, Swanson MS, Minvielle-Sebastia L J Biol Chem 2005-07-01 (280) 15894541
Complete DNA sequence of yeast chromosome XI. Dujon B, Alexandraki D, Andre B, Ansorge W, Baladron V, Ballesta JP, Banrevi A, Bolle PA, Bolotin-Fukuhara M, Bossier P, et al. Nature 1994-06-02 (369) 8196765
PAN3 encodes a subunit of the Pab1p-dependent poly(A) nuclease in Saccharomyces cerevisiae. Brown CE, Tarun SZ Jr, Boeck R, Sachs AB Mol Cell Biol 1996-10-01 (16) 8816488
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res 2007-03-01 (6) 17330950
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356
Posttranscriptional regulation of the RAD5 DNA repair gene by the Dun1 kinase and the Pan2-Pan3 poly(A)-nuclease complex contributes to survival of replication blocks. Hammet A, Pike BL, Heierhorst J J Biol Chem 2002-06-21 (277) 11953437
Combining chemical genetics and proteomics to identify protein kinase substrates. Dephoure N, Howson RW, Blethrow JD, Shokat KM, O'Shea EK Proc Natl Acad Sci U S A 2005-12-13 (102) 16330754



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.