Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonucleases P/MRP protein subunit POP4

 
Known also as: RNA-processing protein POP4, RNases MRP/P 32.9 kDa subunit

Known abbreviations: POP4, YBR257W, YBR1725

FUNCTION:

  1. Component of RNase P complex ( which cleaves tRNA precursors to generate mature 5' ends)  (PMID: 11880623) and RNase MRP (which cleaves pre-rRNA complexes and mRNA in its 5' untranslated region - UTR)  (PMID: 14729943)
  2. pre-tRNA processing at 5' the end (PMID: 9620854, 9085845)
  3. pre-rRNA processing at site A3 in the Interna Transcribed Spacer 1 (ITS1)  (participation in synthesis of short form of 5.8S rRNA - 5.8S(S)) (PMID: 16618965, 9620854, 8247008, 9085845)
  4. regulation of the cell cycle through the degradation of specific mRNAs (PMID: 14729943)
  5. Box C/D intron-encoded small nucleolar RNAs (snoRNAs) processing (PMID: 18713869)
  6. RNA binding and interaction with seven of the eight protein subunits of Rnase P (PMID: 11880623)
CELLULAR LOCALIZATION:

Nucleolus (PMID: 11880623, 82470083)




This protein can be a part of a given complexes: Activities in which Ribonucleases P/MRP protein subunit POP4 is involved: Pathways in which Ribonucleases P/MRP protein subunit POP4 is involved:

NCBI GI number(s): 6319734
296142922
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P38336 P38336
BRENDA - -
KEGG sce:YBR257W sce:YBR257W
PFAM: PF01868
PF01868
InterPro: IPR002730
IPR016848
IPR023534
IPR002730
IPR016848
IPR023534
CATH: - -
SCOP: - -


Protein sequence:
MDRTQTFIKDCLFTKCLEDPEKPFNENRFQDTLLLLPTDGGLTSRLQRQQ
RKSKLNLDNLQKVSQLESADKQLEKRDYQRINKNSKIALREYINNCKKNT
KKCLKLAYENKITDKEDLLHYIEEKHPTIYESLPQYVDFVPMYKELWINY
IKELLNITKNLKTFNGSLALLKLSMADYNGALLRVTKSKNKTLIGLQGIV
IWDSQKFFIMIVKGNIIDEIKCIPKKGTVFQFEIPISDDDDSALRYSILG
DRFKYRSVDRAGRKFKSRRCDDMLYYIQN

Ribonucleases P/MRP protein subunit POP4 (Saccharomyces cerevisiae) is product of expression of POP4 gene.

Ribonucleases P/MRP protein subunit POP4 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Nuclear RNase MRP is required for correct processing of pre-5.8S rRNA in Saccharomyces cerevisiae. Schmitt ME, Clayton DA Mol Cell Biol 1993-12-01 (13) 8247008
A novel protein shared by RNase MRP and RNase P. Chu S, Zengel JM, Lindahl L RNA 1997-04-01 (3) 9085845
Purification and characterization of the nuclear RNase P holoenzyme complex reveals extensive subunit overlap with RNase MRP. Chamberlain JR, Lee Y, Lane WS, Engelke DR Genes Dev 1998-06-01 (12) 9620854
Interactions among the protein and RNA subunits of Saccharomyces cerevisiae nuclear RNase P. Houser-Scott F, Xiao S, Millikin CE, Zengel JM, Lindahl L, Engelke DR Proc Natl Acad Sci U S A 2002-03-05 (99) 11880623
RNase MRP cleaves the CLB2 mRNA to promote cell cycle progression: novel method of mRNA degradation. Gill T, Cai T, Aulds J, Wierzbicki S, Schmitt ME Mol Cell Biol 2004-01-01 (24) 14729943
Functional characterization of the conserved amino acids in Pop1p, the largest common protein subunit of yeast RNases P and MRP. Xiao S, Hsieh J, Nugent RL, Coughlin DJ, Fierke CA, Engelke DR RNA 2006-06-01 (12) 16618965
Complete DNA sequence of yeast chromosome II. Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, Brandt T, Brendel M, Bruckner M, Bussereau F, Christiansen C, Contreras R, Crouzet M, Cziepluch C, Demolis N, Delaveau T, Doignon F, Domdey H, Dusterhus S, Dubois E, Dujon B, El Bakkoury M, Entian KD EMBO J 1994-12-15 (13) 7813418
Characterization and purification of Saccharomyces cerevisiae RNase MRP reveals a new unique protein component. Salinas K, Wierzbicki S, Zhou L, Schmitt ME J Biol Chem 2005-03-25 (280) 15637077
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
The complete sequence of a 19,482 bp segment located on the right arm of chromosome II from Saccharomyces cerevisiae. Doignon F, Biteau N, Crouzet M, Aigle M Yeast 1993-01-01 (9) 8465606



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-04-16 14:17:38
Edited by a user: kaja
Edited content: Changed name and alternative_names.

Welcome stranger! Click here to login or here to register.