Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

General negative regulator of transcription subunit 3

 
Known also as: IPR012270, IPR007282, IPR007207

Known abbreviations: NOT3, YIL038C

FUNCTION:

Acts as component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover. The NOT protein subcomplex negatively regulates the basal and activated transcription of many genes. Preferentially affects TC-type TATA element-dependent transcription. Could directly or indirectly inhibit component(s) of the general transcription machinery.

SUBUNIT:

Forms a NOT protein complex that comprises NOT1, NOT2, NOT3, NOT4 and NOT5. Subunit of the 1.0 MDa CCR4-NOT core complex that contains CCR4, CAF1, NOT1, NOT2, NOT3, NOT4, NOT5, CAF40 and CAF130. The core complex probably is part of a less characterized 1.9 MDa CCR4-NOT complex.

SUBCELLULAR LOCATION: 

Cytoplasm (Probable). Nucleus.
 




This protein can be a part of a given complexes: Activities in which General negative regulator of transcription subunit 3 is involved: Pathways in which General negative regulator of transcription subunit 3 is involved:

NCBI GI number(s): 730167
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P06102 P06102
BRENDA - -
KEGG sce:YIL038C sce:YIL038C
PFAM: - P06102 (Link - using uniprot id)
InterPro: PF04153
PF04065
PF04153
PF04065
CATH: - -
SCOP: - -


Protein sequence:
MAHRKLQQEVDRVFKKINEGLEIFNSYYERHESCTNNPSQKDKLESDLKR
EVKKLQRLREQIKSWQSSPDIKDKDSLLDYRRSVEIAMEKYKAVEKASKE
KAYSNISLKKSETLDPQERERRDISEYLSQMIDELERQYDSLQVEIDKLL
LLNKKKKTSSTTNDEKKEQYKRFQARYRWHQQQMELALRLLANEELDPQD
VKNVQDDINYFVESNQDPDFVEDETIYDGLNLQSNEAIAHEVAQYFASQN
AEDNNTSDANESLQDISKLSKKEQRKLEREAKKAAKLAAKNATGAAIPVA
GPSSTPSPVIPVADASKETERSPSSSPIHNATKPEEAVKTSIKSPRSSAD
NLLPSLQKSPSSATPETPTNVHTHIHQTPNGITGATTLKPATLPAKPAGE
LKWAVAASQAVEKDRKVTSASSTISNTSTKTPTTAAATTTSSNANSRIGS
ALNTPKLSTSSLSLQPDNTGASSSAATAAAVLAAGAAAVHQNNQAFYRNM
SSSHHPLVSLATNPKSEHEVATTVNQNGPENTTKKVMEQKEEESPEERNK
LQVPTFGVFDDDFESDRDSETEPEEEEQPSTPKYLSLEQREAKTNEIKKE
FVSDFETLLLPSGVQEFIMSSELYNSQIESKITYKRSRDMCEISRLVEVP
QGVNPPSPLDAFRSTQQWDVMRCSLRDIIIGSERLKEDSSSIYAKILENF
RTLEMFSLFYNYYFAITPLEREIAYKILNERDWKVSKDGTMWFLRQGEVK
FFNEICEVGDYKIFKLDDWTVIDKINFRLDYSFLQPPVDTASEVRDVSVD
NNNVNDQSNVTLEQQKQEISHGKQLLKQLKQGKISV

General negative regulator of transcription subunit 3 (Saccharomyces cerevisiae) is product of expression of NOT3 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
NOT1(CDC39), NOT2(CDC36), NOT3, and NOT4 encode a global-negative regulator of transcription that differentially affects TATA-element utilization. Collart MA, Struhl K Genes Dev 1994-03-01 (8) 7926748
Purification and characterization of the 1.0 MDa CCR4-NOT complex identifies two novel components of the complex. Chen J, Rappsilber J, Chiang YC, Russell P, Mann M, Denis CL J Mol Biol 2001-12-07 (314) 11733989
The nucleotide sequence of Saccharomyces cerevisiae chromosome IX. Churcher C, Bowman S, Badcock K, Bankier A, Brown D, Chillingworth T, Connor R, Devlin K, Gentles S, Hamlin N, Harris D, Horsnell T, Hunt S, Jagels K, Jones M, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Rowley N, Skelton J, Smith V, Barrell B, et al. Nature 1997-05-01 (387) 9169870
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res 2007-03-01 (6) 17330950
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356
Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway. Gruhler A, Olsen JV, Mohammed S, Mortensen P, Faergeman NJ, Mann M, Jensen ON Mol Cell Proteomics 2005-03-01 (4) 15665377
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF Proc Natl Acad Sci U S A 2007-01-13 (104) 17287358
Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae. Ficarro SB, McCleland ML, Stukenberg PT, Burke DJ, Ross MM, Shabanowitz J, Hunt DF, White FM Nat Biotechnol 2002-03-01 (20) 11875433
The NOT proteins are part of the CCR4 transcriptional complex and affect gene expression both positively and negatively. Liu HY, Badarinarayana V, Audino DC, Rappsilber J, Mann M, Denis CL EMBO J 1998-01-16 (17) 9463387
Nucleotide sequence of the yeast cell division cycle start genes CDC28, CDC36, CDC37, and CDC39, and a structural analysis of the predicted products. Ferguson J, Ho JY, Peterson TA, Reed SI Nucleic Acids Res 1986-08-26 (14) 3018676



Add your own comment!


There are no comments yet.

Last modification of this entry: 2010-04-12 22:45:03
Edited by a user: kaja
Edited content: Changed abbreviations.

Welcome stranger! Click here to login or here to register.