Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonucleases P/MRP protein subunit POP5

 
Known also as: RNA-processing protein POP5, RNases P/MRP 19.6 kDa subunit

Known abbreviations: POP5, YAL033W, FUN53

FUNCTION:

  1. Component of RNase P complex ( which cleaves tRNA precursors to generate mature 5' ends)  (PMID: 11880623) and RNase MRP (which cleaves pre-rRNA complexes and mRNA in its 5' untranslated region - UTR)  (PMID: 14729943)
  2. pre-tRNA processing at 5' the end (PMID: 9620854)
  3. pre-rRNA processing at site A3 in the Interna Transcribed Spacer 1 (ITS1) (participation in synthesis of short form of 5.8S rRNA - 5.8S(S)) (PMID: 16618965, 9620854, 8247008)
  4. regulation of the cell cycle through the degradation of specific mRNAs (PMID: 14729943)
  5. Box C/D intron-encoded small nucleolar RNAs (snoRNAs) processing (PMID: 18713869)

CELLULAR LOCALIZATION:

Cytoplasm.
Nucleolus (PMID: 11880623, 8247008).

CATALYTIC ACTIVITY:

Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.




This protein can be a part of a given complexes: Activities in which Ribonucleases P/MRP protein subunit POP5 is involved: Pathways in which Ribonucleases P/MRP protein subunit POP5 is involved:

NCBI GI number(s): 6319286
296142503
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P28005 P28005
BRENDA - -
KEGG sce:YAL033W sce:YAL033W
PFAM: PF01900
PF01900
InterPro: IPR002759
IPR002759
CATH: - -
SCOP: - -


Protein sequence:
MVRLKSRYILFEIIFPPTDTNVEESVSKADILLSHHRASPADVSIKSILQ
EIRRSLSLNLGDYGSAKCNSLLQLKYFSNKTSTGIIRCHREDCDLVIMAL
MLMSKIGDVDGLIVNPVKVSGTIKKIEQFAMRRNSKILNIIKCSQSSHLS
DNDFIINDFKKIGRENENENEDD

Ribonucleases P/MRP protein subunit POP5 (Saccharomyces cerevisiae) is product of expression of POP5 gene.

Ribonucleases P/MRP protein subunit POP5 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
Nuclear RNase MRP is required for correct processing of pre-5.8S rRNA in Saccharomyces cerevisiae. Schmitt ME, Clayton DA Mol Cell Biol 1993-12-01 (13) 8247008
Purification and characterization of the nuclear RNase P holoenzyme complex reveals extensive subunit overlap with RNase MRP. Chamberlain JR, Lee Y, Lane WS, Engelke DR Genes Dev 1998-06-01 (12) 9620854
Interactions among the protein and RNA subunits of Saccharomyces cerevisiae nuclear RNase P. Houser-Scott F, Xiao S, Millikin CE, Zengel JM, Lindahl L, Engelke DR Proc Natl Acad Sci U S A 2002-03-05 (99) 11880623
RNase MRP cleaves the CLB2 mRNA to promote cell cycle progression: novel method of mRNA degradation. Gill T, Cai T, Aulds J, Wierzbicki S, Schmitt ME Mol Cell Biol 2004-01-01 (24) 14729943
Functional characterization of the conserved amino acids in Pop1p, the largest common protein subunit of yeast RNases P and MRP. Xiao S, Hsieh J, Nugent RL, Coughlin DJ, Fierke CA, Engelke DR RNA 2006-06-01 (12) 16618965
Genome-wide search for yeast RNase P substrates reveals role in maturation of intron-encoded box C/D small nucleolar RNAs. Coughlin DJ, Pleiss JA, Walker SC, Whitworth GB, Engelke DR Proc Natl Acad Sci U S A 2008-08-26 (105) 18713869
The nucleotide sequence of chromosome I from Saccharomyces cerevisiae. Bussey H, Kaback DB, Zhong W, Vo DT, Clark MW, Fortin N, Hall J, Ouellette BF, Keng T, Barton AB, et al. Proc Natl Acad Sci U S A 1995-04-25 (92) 7731988
Characterization and purification of Saccharomyces cerevisiae RNase MRP reveals a new unique protein component. Salinas K, Wierzbicki S, Zhou L, Schmitt ME J Biol Chem 2005-03-25 (280) 15637077
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Molecular analysis of Saccharomyces cerevisiae chromosome I. On the number of genes and the identification of essential genes using temperature-sensitive-lethal mutations. Harris SD, Cheng J, Pugh TA, Pringle JR J Mol Biol 1992-05-05 (225) 1583694



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-04-16 14:16:42
Edited by a user: kaja
Edited content: Changed description.

Welcome stranger! Click here to login or here to register.