Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonucleases P/MRP protein subunit POP6

 
Known also as: RNA-processing protein POP6, RNases P/MRP 18.2 kDa subunit

Known abbreviations: POP6, YGR030C

FUNCTION:

 

  1. Component of RNase P complex ( which cleaves tRNA precursors to generate mature 5' ends)  (PMID: 11880623) and RNase MRP (which cleaves pre-rRNA complexes and mRNA in its 5' untranslated region - UTR)  (PMID: 14729943)
  2. pre-tRNA processing at 5' the end (PMID: 9620854)
  3. pre-rRNA processing at site A3 in the Interna Transcribed Spacer 1 (ITS1) (participation in synthesis of short form of 5.8S rRNA - 5.8S(S)) (PMID: 16618965, 9620854, 8247008)
  4. regulation of the cell cycle through the degradation of specific mRNAs (PMID: 14729943)
  5. Box C/D intron-encoded small nucleolar RNAs (snoRNAs) processing (PMID: 18713869)
  6. 6. Interaction with essential P3 subdomain of Rnase P/RNase MRP RNA (in a complex  with Pop7). Pop6/Pop7 comlex is probably involves in interaction of Pop1 with P3 domain as an adapter or mediator (PMID: 17717080)

CELLULAR LOCALIZATION:

Nucleolus (PMID: 11880623, 8247008)

 

CATALYTIC ACTIVITY:

Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.




This protein can be a part of a given complexes: Activities in which Ribonucleases P/MRP protein subunit POP6 is involved: Pathways in which Ribonucleases P/MRP protein subunit POP6 is involved:

NCBI GI number(s): 6321467
296145066
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P53218 P53218
BRENDA - -
KEGG sce:YGR030C sce:YGR030C
PFAM: PF01918
PF01918
InterPro: IPR002775
IPR020224
IPR002775
IPR020224
CATH: - -
SCOP: - -
Solved crystal structures: 3IAB
[PDB] [details]


Protein sequence:
MINGVYYNEISRDLDISSSTQCLRFLKETVIPSLANNGNNSTSIQYHGIS
KNDNIKKSVNKLDKQINMADRSLGLQQVVCIFSYGPHIQKMLSILEIFKK
GYIKNNKKIYQWNKLTSFDIKREGRNELQEERLKVPILVTLVSDSEIIDL
NLHSFTKQ

Ribonucleases P/MRP protein subunit POP6 (Saccharomyces cerevisiae) is product of expression of POP6 gene.

Ribonucleases P/MRP protein subunit POP6 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
Nuclear RNase MRP is required for correct processing of pre-5.8S rRNA in Saccharomyces cerevisiae. Schmitt ME, Clayton DA Mol Cell Biol 1993-12-01 (13) 8247008
Purification and characterization of the nuclear RNase P holoenzyme complex reveals extensive subunit overlap with RNase MRP. Chamberlain JR, Lee Y, Lane WS, Engelke DR Genes Dev 1998-06-01 (12) 9620854
Interactions among the protein and RNA subunits of Saccharomyces cerevisiae nuclear RNase P. Houser-Scott F, Xiao S, Millikin CE, Zengel JM, Lindahl L, Engelke DR Proc Natl Acad Sci U S A 2002-03-05 (99) 11880623
RNase MRP cleaves the CLB2 mRNA to promote cell cycle progression: novel method of mRNA degradation. Gill T, Cai T, Aulds J, Wierzbicki S, Schmitt ME Mol Cell Biol 2004-01-01 (24) 14729943
Functional characterization of the conserved amino acids in Pop1p, the largest common protein subunit of yeast RNases P and MRP. Xiao S, Hsieh J, Nugent RL, Coughlin DJ, Fierke CA, Engelke DR RNA 2006-06-01 (12) 16618965
Specific binding of a Pop6/Pop7 heterodimer to the P3 stem of the yeast RNase MRP and RNase P RNAs. Perederina A, Esakova O, Koc H, Schmitt ME, Krasilnikov AS RNA 2007-10-01 (13) 17717080
Genome-wide search for yeast RNase P substrates reveals role in maturation of intron-encoded box C/D small nucleolar RNAs. Coughlin DJ, Pleiss JA, Walker SC, Whitworth GB, Engelke DR Proc Natl Acad Sci U S A 2008-08-26 (105) 18713869
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K Nature 1997-05-01 (387) 9169869
Characterization and purification of Saccharomyces cerevisiae RNase MRP reveals a new unique protein component. Salinas K, Wierzbicki S, Zhou L, Schmitt ME J Biol Chem 2005-03-25 (280) 15637077
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII. Rieger M, Bruckner M, Schafer M, Muller-Auer S Yeast 1997-09-15 (13) 9290212



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-04-16 14:16:52
Edited by a user: kaja
Edited content: Changed description.

Welcome stranger! Click here to login or here to register.