Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonucleases P/MRP protein subunit POP7

 
Known also as: RNA-processing protein POP7, RNases P/MRP 15.8 kDa subunit

Known abbreviations: POP7, RPP2, YBR167C, YBR1219

FUNCTION:

  1. Component of RNase P complex (which cleaves tRNA precursors to generate mature 5' ends)  (PMID: 11880623, 9618478) and RNase MRP (which cleaves pre-rRNA complexes and mRNA in its 5' untranslated region - UTR)  (PMID: 14729943, 9618478)
  2. pre-tRNA processing at 5' the end (PMID: 9620854, 9618478)
  3. pre-rRNA processing at site A3 in the Interna Transcribed Spacer 1 (ITS1) (participation in synthesis of short form of 5.8S rRNA - 5.8S(S)) (PMID: 16618965, 9620854,  8247008, 9618478)
  4. regulation of the cell cycle through the degradation of specific mRNAs (PMID: 14729943)
  5. Box C/D intron-encoded small nucleolar RNAs (snoRNAs) processing (PMID: 18713869)
  6. 6. Interaction with essential P3 subdomain of Rnase P/RNase MRP RNA (in a complex  with Pop6). Pop6/Pop7 comlex is probably involves in interaction of Pop1 with P3 domain as an adapter or mediator (PMID: 17717080)

CELLULAR LOCALIZATION:

Nucleolus (PMID: 11880623, 8247008)

CATALYTIC ACTIVITY:

Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.




This protein can be a part of a given complexes: Activities in which Ribonucleases P/MRP protein subunit POP7 is involved: Pathways in which Ribonucleases P/MRP protein subunit POP7 is involved:

NCBI GI number(s): 6319644
296142831
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P38291 P38291
BRENDA - -
KEGG sce:YBR167C sce:YBR167C
PFAM: - P38291 (Link - using uniprot id)
InterPro: IPR020241
IPR020241
CATH: - -
SCOP: - -
Solved crystal structures: 3IAB
[PDB] [details]


Protein sequence:
MALKKNTHNKSTKRVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINK
FLDSVHKQGSSYVAVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVL
DEVITEGQADIDMESDVEDDDKETQLKKRAVSGVELRIYV

Ribonucleases P/MRP protein subunit POP7 (Saccharomyces cerevisiae) is product of expression of POP7 gene.

Ribonucleases P/MRP protein subunit POP7 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
Nuclear RNase MRP is required for correct processing of pre-5.8S rRNA in Saccharomyces cerevisiae. Schmitt ME, Clayton DA Mol Cell Biol 1993-12-01 (13) 8247008
Rpp2, an essential protein subunit of nuclear RNase P, is required for processing of precursor tRNAs and 35S precursor rRNA in Saccharomyces cerevisiae. Stolc V, Katz A, Altman S Proc Natl Acad Sci U S A 1998-06-09 (95) 9618478
Purification and characterization of the nuclear RNase P holoenzyme complex reveals extensive subunit overlap with RNase MRP. Chamberlain JR, Lee Y, Lane WS, Engelke DR Genes Dev 1998-06-01 (12) 9620854
Interactions among the protein and RNA subunits of Saccharomyces cerevisiae nuclear RNase P. Houser-Scott F, Xiao S, Millikin CE, Zengel JM, Lindahl L, Engelke DR Proc Natl Acad Sci U S A 2002-03-05 (99) 11880623
RNase MRP cleaves the CLB2 mRNA to promote cell cycle progression: novel method of mRNA degradation. Gill T, Cai T, Aulds J, Wierzbicki S, Schmitt ME Mol Cell Biol 2004-01-01 (24) 14729943
Functional characterization of the conserved amino acids in Pop1p, the largest common protein subunit of yeast RNases P and MRP. Xiao S, Hsieh J, Nugent RL, Coughlin DJ, Fierke CA, Engelke DR RNA 2006-06-01 (12) 16618965
Specific binding of a Pop6/Pop7 heterodimer to the P3 stem of the yeast RNase MRP and RNase P RNAs. Perederina A, Esakova O, Koc H, Schmitt ME, Krasilnikov AS RNA 2007-10-01 (13) 17717080
Genome-wide search for yeast RNase P substrates reveals role in maturation of intron-encoded box C/D small nucleolar RNAs. Coughlin DJ, Pleiss JA, Walker SC, Whitworth GB, Engelke DR Proc Natl Acad Sci U S A 2008-08-26 (105) 18713869
Complete DNA sequence of yeast chromosome II. Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, Brandt T, Brendel M, Bruckner M, Bussereau F, Christiansen C, Contreras R, Crouzet M, Cziepluch C, Demolis N, Delaveau T, Doignon F, Domdey H, Dusterhus S, Dubois E, Dujon B, El Bakkoury M, Entian KD EMBO J 1994-12-15 (13) 7813418
Characterization and purification of Saccharomyces cerevisiae RNase MRP reveals a new unique protein component. Salinas K, Wierzbicki S, Zhou L, Schmitt ME J Biol Chem 2005-03-25 (280) 15637077
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-04-16 14:17:02
Edited by a user: kaja
Edited content: Changed description.

Welcome stranger! Click here to login or here to register.