Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonucleases P/MRP protein subunit POP8

 
Known also as: RNA-processing protein POP8, RNases P/MRP 15.5 kDa subunit

Known abbreviations: POP8, YBL018C, YBL0301

FUNCTION:

 

  1. Component of RNase P complex ( which cleaves tRNA precursors to generate mature 5' ends)  (PMID: 11880623) and RNase MRP (which cleaves pre-rRNA complexes and mRNA in its 5' untranslated region - UTR)  (PMID: 14729943)
  2. pre-tRNA processing at 5' the end (PMID: 9620854)
  3. regulation of the cell cycle through the degradation of specific mRNAs (PMID: 14729943) 
  4. Box C/D intron-encoded small nucleolar RNAs (snoRNAs) processing ( PMID: 18713869)
CELLULAR LOCALIZATION:
 
Nucleolus (PMID: 11880623, 8247008)
 
CATALYTIC ACTIVITY:

Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.




This protein can be a part of a given complexes: Activities in which Ribonucleases P/MRP protein subunit POP8 is involved: Pathways in which Ribonucleases P/MRP protein subunit POP8 is involved:

NCBI GI number(s): 6319453
296142650
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P38208 P38208
BRENDA - -
KEGG sce:YBL018C sce:YBL018C
PFAM: - P38208 (Link - using uniprot id)
InterPro: IPR020347
IPR020347
CATH: - -
SCOP: - -


Protein sequence:
MGKKTFREWQYFKLSITSFDQDVDDAHAIDQMTWRQWLNNALKRSYGIFG
EGVEYSFLHVDDKLAYIRVNHADKDTFSSSISTYISTDELVGSPLTVSIL
QESSSLRLLEVTDDDRLWLKKVMEEEEQDCKCI

Ribonucleases P/MRP protein subunit POP8 (Saccharomyces cerevisiae) is product of expression of POP8 gene.

Ribonucleases P/MRP protein subunit POP8 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
Nuclear RNase MRP is required for correct processing of pre-5.8S rRNA in Saccharomyces cerevisiae. Schmitt ME, Clayton DA Mol Cell Biol 1993-12-01 (13) 8247008
Purification and characterization of the nuclear RNase P holoenzyme complex reveals extensive subunit overlap with RNase MRP. Chamberlain JR, Lee Y, Lane WS, Engelke DR Genes Dev 1998-06-01 (12) 9620854
Interactions among the protein and RNA subunits of Saccharomyces cerevisiae nuclear RNase P. Houser-Scott F, Xiao S, Millikin CE, Zengel JM, Lindahl L, Engelke DR Proc Natl Acad Sci U S A 2002-03-05 (99) 11880623
RNase MRP cleaves the CLB2 mRNA to promote cell cycle progression: novel method of mRNA degradation. Gill T, Cai T, Aulds J, Wierzbicki S, Schmitt ME Mol Cell Biol 2004-01-01 (24) 14729943
Genome-wide search for yeast RNase P substrates reveals role in maturation of intron-encoded box C/D small nucleolar RNAs. Coughlin DJ, Pleiss JA, Walker SC, Whitworth GB, Engelke DR Proc Natl Acad Sci U S A 2008-08-26 (105) 18713869
Complete DNA sequence of yeast chromosome II. Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, Brandt T, Brendel M, Bruckner M, Bussereau F, Christiansen C, Contreras R, Crouzet M, Cziepluch C, Demolis N, Delaveau T, Doignon F, Domdey H, Dusterhus S, Dubois E, Dujon B, El Bakkoury M, Entian KD EMBO J 1994-12-15 (13) 7813418
Characterization and purification of Saccharomyces cerevisiae RNase MRP reveals a new unique protein component. Salinas K, Wierzbicki S, Zhou L, Schmitt ME J Biol Chem 2005-03-25 (280) 15637077
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-04-16 14:17:12
Edited by a user: kaja
Edited content: No fields changed.

Welcome stranger! Click here to login or here to register.