Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonuclease P protein subunit RPR2

 
Known also as: RNA-processing protein RPR2, RNase P 16.4 kDa subunit

Known abbreviations: RPR2, YIR015W

FUNCTION:

  1. Component of RNase P complex (which cleaves tRNA precursors to generate mature 5' ends)  (PMID: 11880623)
  2. pre-tRNA processing at 5' the end (PMID: 9620854)
  3. Interaction with itself and Pop4 (PMID: 11880623)
  4. Box C/D intron-encoded small nucleolar RNAs (snoRNAs) processing ( PMID: 18713869)
CELLULAR LOCALIZATION:
 
Nucleolus (PMID: 11880623)
 
CATALYTIC ACTIVITY:

Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.




This protein can be a part of a given complexes: Activities in which Ribonuclease P protein subunit RPR2 is involved: Pathways in which Ribonuclease P protein subunit RPR2 is involved:

NCBI GI number(s): 6322205
296145781
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P40571 P40571
BRENDA - -
KEGG sce:YIR015W sce:YIR015W
PFAM: PF04032
PF04032
InterPro: IPR007175
IPR007175
CATH: - -
SCOP: - -


Protein sequence:
MGKKAHGGKMKPEIDENGTLLVPPPRTIANQDHFHRLNYLYQISAYQTRA
RQKARTDAHTPLARNYIKSMDLISKKTKTSLLPTIKRTICKKCHRLLWTP
KKLEITSDGALSVMCGCGTVKRFNIGADPNYRTYSEREGNLLNS

Ribonuclease P protein subunit RPR2 (Saccharomyces cerevisiae) is product of expression of RPR2 gene.

Ribonuclease P protein subunit RPR2 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
Purification and characterization of the nuclear RNase P holoenzyme complex reveals extensive subunit overlap with RNase MRP. Chamberlain JR, Lee Y, Lane WS, Engelke DR Genes Dev 1998-06-01 (12) 9620854
Interactions among the protein and RNA subunits of Saccharomyces cerevisiae nuclear RNase P. Houser-Scott F, Xiao S, Millikin CE, Zengel JM, Lindahl L, Engelke DR Proc Natl Acad Sci U S A 2002-03-05 (99) 11880623
Genome-wide search for yeast RNase P substrates reveals role in maturation of intron-encoded box C/D small nucleolar RNAs. Coughlin DJ, Pleiss JA, Walker SC, Whitworth GB, Engelke DR Proc Natl Acad Sci U S A 2008-08-26 (105) 18713869
The nucleotide sequence of Saccharomyces cerevisiae chromosome IX. Churcher C, Bowman S, Badcock K, Bankier A, Brown D, Chillingworth T, Connor R, Devlin K, Gentles S, Hamlin N, Harris D, Horsnell T, Hunt S, Jagels K, Jones M, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Rowley N, Skelton J, Smith V, Barrell B, et al. Nature 1997-05-01 (387) 9169870
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.