Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonuclease MRP protein subunit SNM1

 
Known also as: RNA-processing protein SNM1, RNase MRP 22.5 kDa subunit

Known abbreviations: SNM1, YDR478W, D8035.21

 

FUNCTION:
  1. Component of RNase MRP (which cleaves pre-rRNA complexes and mRNA in its 5' untranslated region - UTR)  (PMID: 14729943)
  2. pre-rRNA processing at site A3 in the Interna Transcribed Spacer 1 (ITS1) (participation in synthesis of short form of 5.8S rRNA - 5.8S(S) ) (PMID: 16618965, 9620854,  8247008)
  3. regulation of the cell cycle through the degradation of specific mRNAs (PMID: 14729943)
  4. Interaction with itself and Pop4 (PMID: 11880623)
  5. RNA (Nme1) binding (PMID: 16618965)

CELLULAR LOCALIZATION:

nucleolus (PMID: 8247008)




This protein can be a part of a given complexes: Activities in which Ribonuclease MRP protein subunit SNM1 is involved: Pathways in which Ribonuclease MRP protein subunit SNM1 is involved:

NCBI GI number(s): 6320686
296143819
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P40993 P40993
BRENDA - -
KEGG sce:YDR478W sce:YDR478W
PFAM: PF04032
PF04032
InterPro: IPR007175
IPR007175
CATH: - -
SCOP: - -


Protein sequence:
MNKDQAEKYQERSLRQKYNLLHVLPTLNSRALSGLYYKNFHNSVKRYQIM
LPEQLKSGKFCSHCGCVYVPNFNASLQLTTNTEQGDSDELGGESMEGPKK
CIQVNCLNCEKSKLFEWKSEFVVPTFGQDVSPMINSTSSGKVSYAVKKPQ
KSKTSTGKERSKKRKLNSLTNLLSKRNQEKKMEKKKSSSLSLESFMKS

Ribonuclease MRP protein subunit SNM1 (Saccharomyces cerevisiae) is product of expression of SNM1 gene.

Ribonuclease MRP protein subunit SNM1 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
Nuclear RNase MRP is required for correct processing of pre-5.8S rRNA in Saccharomyces cerevisiae. Schmitt ME, Clayton DA Mol Cell Biol 1993-12-01 (13) 8247008
Purification and characterization of the nuclear RNase P holoenzyme complex reveals extensive subunit overlap with RNase MRP. Chamberlain JR, Lee Y, Lane WS, Engelke DR Genes Dev 1998-06-01 (12) 9620854
Interactions among the protein and RNA subunits of Saccharomyces cerevisiae nuclear RNase P. Houser-Scott F, Xiao S, Millikin CE, Zengel JM, Lindahl L, Engelke DR Proc Natl Acad Sci U S A 2002-03-05 (99) 11880623
RNase MRP cleaves the CLB2 mRNA to promote cell cycle progression: novel method of mRNA degradation. Gill T, Cai T, Aulds J, Wierzbicki S, Schmitt ME Mol Cell Biol 2004-01-01 (24) 14729943
Functional characterization of the conserved amino acids in Pop1p, the largest common protein subunit of yeast RNases P and MRP. Xiao S, Hsieh J, Nugent RL, Coughlin DJ, Fierke CA, Engelke DR RNA 2006-06-01 (12) 16618965
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature 1997-05-01 (387) 9169867
Characterization and purification of Saccharomyces cerevisiae RNase MRP reveals a new unique protein component. Salinas K, Wierzbicki S, Zhou L, Schmitt ME J Biol Chem 2005-03-25 (280) 15637077
Characterization of a unique protein component of yeast RNase MRP: an RNA-binding protein with a zinc-cluster domain. Schmitt ME, Clayton DA Genes Dev 1994-11-01 (8) 7958920
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.