Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonuclease MRP protein subunit RMP1

 
Known also as: RNA-processing protein RMP1, RNase MRP 23.6 kDa subunit

Known abbreviations: RMP1, YLR145W

FUNCTION:

  1. Component of RNase MRP (which cleaves pre-rRNA complexes and mRNA in its 5' untranslated region - UTR)  (PMID: 14729943)
  2. pre-rRNA processing at site A3 in the Interna Transcribed Spacer 1 (ITS1) (participation in synthesis of short form of 5.8S rRNA - 5.8S(S) ) (PMID: 16618965, 9620854,  8247008)
  3. 3. regulation of the cell cycle through the degradation of specific mRNAs (PMID: 14729943) 

CELLULAR LOCALIZATION:

Membrane, Single-pass membrane protein (Potential).
Cytoplasm. Nucleus. (PMID: 8247008)




This protein can be a part of a given complexes: Activities in which Ribonuclease MRP protein subunit RMP1 is involved: Pathways in which Ribonuclease MRP protein subunit RMP1 is involved:

NCBI GI number(s): 6323174
296146675
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q12530 Q12530
BRENDA - -
KEGG sce:YLR145W sce:YLR145W
PFAM: - Q12530 (Link - using uniprot id)
InterPro: - Q12530 (Link - using uniprot id)
CATH: - -
SCOP: - -


Protein sequence:
MDEMDNVIRSLEQEYRLILLLNHRNKNQHRAASWYGSFNEMKRNCGQIIT
LFSSRRLQAKRLKDVEWVKLHRLLQRALFRQLKRWYWQFNGVIALGQFVT
LGCTLVTLLANVRALYMRLWEINETEFIRCGCLIKNLPRTKAKSVVNDVE
ELGEIIDEDIGNNVQENELVITSIPKPLTENCKKKKKRKKKNKSAIDGIF
G

Ribonuclease MRP protein subunit RMP1 (Saccharomyces cerevisiae) is product of expression of RMP1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
Nuclear RNase MRP is required for correct processing of pre-5.8S rRNA in Saccharomyces cerevisiae. Schmitt ME, Clayton DA Mol Cell Biol 1993-12-01 (13) 8247008
Purification and characterization of the nuclear RNase P holoenzyme complex reveals extensive subunit overlap with RNase MRP. Chamberlain JR, Lee Y, Lane WS, Engelke DR Genes Dev 1998-06-01 (12) 9620854
RNase MRP cleaves the CLB2 mRNA to promote cell cycle progression: novel method of mRNA degradation. Gill T, Cai T, Aulds J, Wierzbicki S, Schmitt ME Mol Cell Biol 2004-01-01 (24) 14729943
Functional characterization of the conserved amino acids in Pop1p, the largest common protein subunit of yeast RNases P and MRP. Xiao S, Hsieh J, Nugent RL, Coughlin DJ, Fierke CA, Engelke DR RNA 2006-06-01 (12) 16618965
The nucleotide sequence of Saccharomyces cerevisiae chromosome XII. Johnston M, Hillier L, Riles L, Albermann K, Andre B, Ansorge W, Benes V, Bruckner M, Delius H, Dubois E, Dusterhoft A, Entian KD, Floeth M, Goffeau A, Hebling U, Heumann K, Heuss-Neitzel D, Hilbert H, Hilger F, Kleine K, Kotter P, Louis EJ, Messenguy F, Mewes HW, Hoheisel JD, et al. Nature 1997-05-01 (387) 9169871
Characterization and purification of Saccharomyces cerevisiae RNase MRP reveals a new unique protein component. Salinas K, Wierzbicki S, Zhou L, Schmitt ME J Biol Chem 2005-03-25 (280) 15637077
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.