Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonuclease Z

 
Known also as: tRNA 3 endonuclease, tRNase Z

Known abbreviations: TRZ1, YKR079C

FUNCTION:

  1. 3' end of tRNA maturation  (PMID: 15892892)
  2. 35 rRNA processing  (PMID: 15892892)
  3. Amino-domain (enzymaticaly inactive, modulate the specificity of carboxy domain) and carboxy-domain (enzymaticaly active), which are structuraly homologous (PMID: 15892892)
  4. Conserved elements: histidine motifs located near the fron of carboxy domain, P-loop sequence in carboxy domain, which are important for Trz1 biological function  (PMID: 15892892)
  5. belongs to RNase ZL (long) family (PMID: 15892892)

CELLULAR LOCALIZATION:

Mitochondrion (PMID: 15892892)

COFACTOR:

Zinc (Probable).

SUBUNIT STRUCTURE:

Homodimer (By similarity).




Activities in which Ribonuclease Z is involved: Pathways in which Ribonuclease Z is involved:

NCBI GI number(s): 6322932
296146449
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P36159 P36159
BRENDA - -
KEGG sce:YKR079C sce:YKR079C
PFAM: - P36159 (Link - using uniprot id)
InterPro: - P36159 (Link - using uniprot id)
CATH: - -
SCOP: - -


Protein sequence:
MFTFIPITHPTSDTKHPLLLVQSAHGEKYFFGKIGEGSQRSLTENKIRIS
KLKDIFLTGELNWSDIGGLPGMILTIADQGKSNLVLHYGNDILNYIVSTW
RYFVFRFGIDLNDHIMKDKEVYKDKIIAVKSFNVLKNGGEDRLGVFDSFQ
KGVLRSIVAKMFPKHAPTDRYDPSSDPHLNVELPDLDAKVEVSTNYEISF
SPVRGKFKVEEAIKLGVPKGPLFAKLTKGQTITLDNGIVVTPEQVLENER
HFAKVLILDIPDDLYLNAFVEKFKDYDCAELGMVYYFLGDEVTINDNLFA
FIDIFEKNNYGKVNHMISHNKISPNTISFFGSALTTLKLKALQVNNYNLP
KTDRVFSKDFYDRFDTPLSRGTSMCKSQEEPLNTIIEKDNIHIFSQNKTV
TFEPFRMNEEPMKCNINGEVADFSWQEIFEEHVKPLEFPLADVDTVINNQ
LHVDNFNNSAEKKKHVEIITLGTGSALPSKYRNVVSTLVKVPFTDADGNT
INRNIMLDAGENTLGTIHRMFSQLAVKSIFQDLKMIYLSHLHADHHLGII
SVLNEWYKYNKDDETSYIYVVTPWQYHKFVNEWLVLENKEILKRIKYISC
EHFINDSFVRMQTQSVPLAEFNEILKENSNQESNRKLELDRDSSYRDVDL
IRQMYEDLSIEYFQTCRAIHCDWAYSNSITFRMDENNEHNTFKVSYSGDT
RPNIEKFSLEIGYNSDLLIHEATLENQLLEDAVKKKHCTINEAIGVSNKM
NARKLILTHFSQRYPKLPQLDNNIDVMAREFCFAFDSMIVDYEKIGEQQR
IFPLLNKAFVEEKEEEEDVDDVESVQDLEVKLKKHKKN

Ribonuclease Z (Saccharomyces cerevisiae) is product of expression of TRZ1 gene.

Ribonuclease Z (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Relaxed transcription in Arabidopsis mitochondria is counterbalanced by RNA stability control mediated by polyadenylation and polynucleotide phosphorylase. Holec S, Lange H, Kuhn K, Alioua M, Borner T, Gagliardi D Mol Cell Biol 2006-04-01 (26) 16537927
PNPase activity determines the efficiency of mRNA 3'-end processing, the degradation of tRNA and the extent of polyadenylation in chloroplasts. Walter M, Kilian J, Kudla J EMBO J 2002-12-16 (21) 12486011
The PNPase, exosome and RNA helicases as the building components of evolutionarily-conserved RNA degradation machines. Lin-Chao S, Chiou NT, Schuster G J Biomed Sci 2007-07-01 (14) 17514363
Two exoribonucleases act sequentially to process mature 3'-ends of atp9 mRNAs in Arabidopsis mitochondria. Perrin R, Meyer EH, Zaepfel M, Kim YJ, Mache R, Grienenberger JM, Gualberto JM, Gagliardi D J Biol Chem 2004-06-11 (279) 15037609
AtmtPNPase is required for multiple aspects of the 18S rRNA metabolism in Arabidopsis thaliana mitochondria. Perrin R, Lange H, Grienenberger JM, Gagliardi D Nucleic Acids Res 2004-01-01 (32) 15459286
Action of RNase II and polynucleotide phosphorylase against RNAs containing stem-loops of defined structure. Spickler C, Mackie GA J Bacteriol 2000-05-01 (182) 10762241
AtPARN is an essential poly(A) ribonuclease in Arabidopsis. Chiba Y, Johnson MA, Lidder P, Vogel JT, van Erp H, Green PJ Gene 2004-03-17 (328) 15019988
Analysis of ABA hypersensitive germination2 revealed the pivotal functions of PARN in stress response in Arabidopsis. Nishimura N, Kitahata N, Seki M, Narusaka Y, Narusaka M, Kuromori T, Asami T, Shinozaki K, Hirayama T Plant J 2005-12-01 (44) 16359390
tRNase Z. Ceballos M, Vioque A Protein Pept Lett 2007-01-01 (14) 17305600
tRNase Z: the end is not in sight. Spath B, Canino G, Marchfelder A Cell Mol Life Sci 2007-09-01 (64) 17599240



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-07-05 15:14:59
Edited by a user: kaja
Edited content: Changed publications.

Welcome stranger! Click here to login or here to register.