Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

tRNA-splicing endonuclease subunit SEN2

 
Known also as: Splicing endonuclease protein 2, tRNA-intron endonuclease SEN2

Known abbreviations: SEN2, YLR105C, L8004.12

FUNCTION:

 
Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. This subunit may anchor the endonuclease complex to the nuclear membrane. Probably carries the active site for 5'-splice site cleavage. 
 
CATALYTIC ACTIVITY:
 
Endonucleolytic cleavage of pre-tRNA, producing 5'-hydroxy and 2',3'-cyclic phosphate termini, and specifically removing the intron.
 
SUBUNIT STRUCTURE:
 
Heterotetramer composed of SEN2, SEN15, SEN34 and SEN54. Interacts directly with SEN54.
 
CELLULAR LOCALIZATION:
 
Nucleus. Endomembrane system; Peripheral membrane protein. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side. Note: The tRNA splicing endonuclease complex is predominantly associated with the outer membrane of mitochondria, suggesting that tRNA splicing mainly takes place on the mitochondrial surface. 

 




This protein can be a part of a given complexes: Activities in which tRNA-splicing endonuclease subunit SEN2 is involved: Pathways in which tRNA-splicing endonuclease subunit SEN2 is involved:

NCBI GI number(s): 6323134
296146641
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P16658 P16658
BRENDA - -
KEGG sce:YLR105C sce:YLR105C
PFAM: PF01974
PF01974
InterPro: IPR011856
IPR006677
IPR006676
IPR016589
IPR011856
IPR006677
IPR006676
IPR016589
CATH: - -
SCOP: - -


Protein sequence:
MSKGRVNQKRYKYPLPIHPVDDLPELILHNPLSWLYWAYRYYKSTNALND
KVHVDFIGDTTLHITVQDDKQMLYLWNNGFFGTGQFSRSEPTWKARTEAR
LGLNDTPLHNRGGTKSNTETEMTLEKVTQQRRLQRLEFKKERAKLERELL
ELRKKGGHIDEENILLEKQRESLRKFKLKQTEDVGIVAQQQDISESNLRD
EDNNLLDENGDLLPLESLELMPVEAMFLTFALPVLDISPACLAGKLFQFD
AKYKDIHSFVRSYVIYHHYRSHGWCVRSGIKFGCDYLLYKRGPPFQHAEF
CVMGLDHDVSKDYTWYSSIARVVGGAKKTFVLCYVERLISEQEAIALWKS
NNFTKLFNSFQVGEVLYKRWVPGRNRD

TRNA-splicing endonuclease subunit SEN2 (Saccharomyces cerevisiae) is product of expression of SEN2 gene.

TRNA-splicing endonuclease subunit SEN2 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome XII. Johnston M, Hillier L, Riles L, Albermann K, Andre B, Ansorge W, Benes V, Bruckner M, Delius H, Dubois E, Dusterhoft A, Entian KD, Floeth M, Goffeau A, Hebling U, Heumann K, Heuss-Neitzel D, Hilbert H, Hilger F, Kleine K, Kotter P, Louis EJ, Messenguy F, Mewes HW, Hoheisel JD, et al. Nature 1997-05-01 (387) 9169871
The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases. Trotta CR, Miao F, Arn EA, Stevens SW, Ho CK, Rauhut R, Abelson JN Cell 1997-06-13 (89) 9200603
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Possibility of cytoplasmic pre-tRNA splicing: the yeast tRNA splicing endonuclease mainly localizes on the mitochondria. Yoshihisa T, Yunoki-Esaki K, Ohshima C, Tanaka N, Endo T Mol Biol Cell 2003-08-01 (14) 12925762
Yeast tRNA-splicing endonuclease is a heterotrimeric enzyme. Rauhut R, Green PR, Abelson J J Biol Chem 1990-10-25 (265) 2211694
Accumulation of pre-tRNA splicing '2/3' intermediates in a Saccharomyces cerevisiae mutant. Ho CK, Rauhut R, Vijayraghavan U, Abelson J EMBO J 1990-04-01 (9) 2182322



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.