Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

General negative regulator of transcription subunit 4

 
Known also as: Modulator of transcription 2

Known abbreviations: NOT4, MOT2, SIG1, SSF1, CCL1

FUNCTION:

Acts as component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover. The NOT protein subcomplex negatively regulates the basal and activated transcription of many genes. Preferentially affects TC-type TATA element-dependent transcription. Could directly or indirectly inhibit component(s) of the general transcription machinery.

SUBUNIT:

Forms a NOT protein complex that comprises NOT1, NOT2, NOT3, NOT4 and NOT5. Subunit of the 1.0 MDa CCR4-NOT core complex that contains CCR4, CAF1, NOT1, NOT2, NOT3, NOT4, NOT5, CAF40 and CAF130. In the complex interacts with NOT1. The core complex probably is part of a less characterized 1.9 MDa CCR4-NOT complex.

SUBCELLULAR LOCALIZATION:

Cytoplasm (Probable). Nucleus.




This protein can be a part of a given complexes: Activities in which General negative regulator of transcription subunit 4 is involved: Pathways in which General negative regulator of transcription subunit 4 is involved:

NCBI GI number(s): 462738
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P34909 P34909
BRENDA - -
KEGG sce:YER068W sce:YER068W
PFAM: - P34909 (Link - using uniprot id)
InterPro: IPR012677
IPR000504
IPR003954
IPR000571
IPR001841
IPR013083
IPR012677
IPR000504
IPR003954
IPR000571
IPR001841
IPR013083
CATH: - -
SCOP: - -


Protein sequence:
MMNPHVQENLQAIHNALSNFDTSFLSEDEEDYCPLCIEPMDITDKNFFPC
PCGYQICQFCYNNIRQNPELNGRCPACRRKYDDENVRYVTLSPEELKMER
AKLARKEKERKHREKERKENEYTNRKHLSGTRVIQKNLVYVVGINPPVPY
EEVAPTLKSEKYFGQYGKINKIVVNRKTPHSNNTTSEHYHHHSPGYGVYI
TFGSKDDAARCIAQVDGTYMDGRLIKAAYGTTKYCSSYLRGLPCPNPNCM
FLHEPGEEADSFNKRELHNKQQAQQQSGGTAFTRSGIHNNISTSTAGSNT
NLLSENFTGTPSPAAMRAQLHHDSHTNAGTPVLTPAPVPAGSNPWGVTQS
ATPVTSINLSKNSSSINLPTLNDSLGHHTTPTTENTITSTTTTTNTNATS
HSHGSKKKQSLAAEEYKDPYDALGNAVDFLDARLHSLSNYQKRPISIKSN
IIDEETYKKYPSLFSWDKIEASKKSDNTLANKLVEILAIKPIDYTASVVQ
FLQSVNVGVNDNITITDNTKTPTQPIRLQTVSQQIQPPLNVSTPPPGIFG
PQHKVPIQQQQMGDTSSRNSSDLLNQLINGRKIIAGN

General negative regulator of transcription subunit 4 (Saccharomyces cerevisiae) is product of expression of MOT2 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
NOT1(CDC39), NOT2(CDC36), NOT3, and NOT4 encode a global-negative regulator of transcription that differentially affects TATA-element utilization. Collart MA, Struhl K Genes Dev 1994-03-01 (8) 7926748
The nucleotide sequence of Saccharomyces cerevisiae chromosome V. Dietrich FS, Mulligan J, Hennessy K, Yelton MA, Allen E, Araujo R, Aviles E, Berno A, Brennan T, Carpenter J, Chen E, Cherry JM, Chung E, Duncan M, Guzman E, Hartzell G, Hunicke-Smith S, Hyman RW, Kayser A, Komp C, Lashkari D, Lew H, Lin D, Mosedale D, Davis RW, et al. Nature 1997-05-01 (387) 9169868
Purification and characterization of the 1.0 MDa CCR4-NOT complex identifies two novel components of the complex. Chen J, Rappsilber J, Chiang YC, Russell P, Mann M, Denis CL J Mol Biol 2001-12-07 (314) 11733989
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res 2007-03-01 (6) 17330950
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356
The NOT proteins are part of the CCR4 transcriptional complex and affect gene expression both positively and negatively. Liu HY, Badarinarayana V, Audino DC, Rappsilber J, Mann M, Denis CL EMBO J 1998-01-16 (17) 9463387
The CCR4 and CAF1 proteins of the CCR4-NOT complex are physically and functionally separated from NOT2, NOT4, and NOT5. Bai Y, Salvadore C, Chiang YC, Collart MA, Liu HY, Denis CL Mol Cell Biol 1999-10-01 (19) 10490603
Molecular characterization of SIG1, a Saccharomyces cerevisiae gene involved in negative regulation of G-protein-mediated signal transduction. Leberer E, Dignard D, Harcus D, Whiteway M, Thomas DY EMBO J 1994-07-01 (13) 8039500
MOT2 encodes a negative regulator of gene expression that affects basal expression of pheromone-responsive genes in Saccharomyces cerevisiae. Cade RM, Errede B Mol Cell Biol 1994-05-01 (14) 8164669
The yeast MOT2 gene encodes a putative zinc finger protein that serves as a global negative regulator affecting expression of several categories of genes, including mating-pheromone-responsive genes. Irie K, Yamaguchi K, Kawase K, Matsumoto K Mol Cell Biol 1994-05-01 (14) 8164670



Add your own comment!


There are no comments yet.

Last modification of this entry: 2010-04-12 22:44:51
Edited by a user: kaja
Edited content: Changed abbreviations.

Welcome stranger! Click here to login or here to register.