Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

tRNA-splicing endonuclease subunit SEN54

 
Known also as: Splicing endonuclease of 54 kDa, tRNA-intron endonuclease SEN54

Known abbreviations: SEN54, YPL083C, LPF3C

 

FUNCTION:
 
Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. May be required to embody the molecular ruler of the complex.
 
SUBUNIT STRUCTURE:
 
tRNA splicing endonuclease is a heterotetramer composed of SEN2, SEN15, SEN34 and SEN54. Interacts directly with SEN2.
 
CELLULAR LOCALIZATION:
 
Nucleus. Endomembrane system; Peripheral membrane protein. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side. Note: The tRNA splicing endonuclease complex is predominantly associated with the outer membrane of mitochondria, suggesting that tRNA splicing mainly takes place on the mitochondrial surface. 



This protein can be a part of a given complexes: Activities in which tRNA-splicing endonuclease subunit SEN54 is involved: Pathways in which tRNA-splicing endonuclease subunit SEN54 is involved:

NCBI GI number(s): 6325174
296148573
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q02825 Q02825
BRENDA - -
KEGG sce:YPL083C sce:YPL083C
PFAM: PF12928
PF12928
InterPro: IPR024337
IPR024336
IPR024337
IPR024336
CATH: - -
SCOP: - -


Protein sequence:
MQFAGKKTDQVTTSNPGFEEEEEEEEELQQDWSQLASLVSKNAALSLPKR
GEKDYEPDGTNLQDLLLYNASKAMFDTISDSIRGTTVKSEVRGYYVPHKH
QAVLLKPKGSFMQTMGRADSTGELWLDFHEFVYLAERGTILPYYRLEAGS
NKSSKHETEILLSMEDLYSLFSSQQEMDQYFVFAHLKRLGFILKPSNQEA
AVKTSFFPLKKQRSNLQAITWRLLSLFKIQELSLFSGFFYSKWNFFFRKY
TTSPQLYQGLNRLVRSVAVPKNKKELLDAQSDREFQKVKDIPLTFKVWKP
HSNFKKRDPGLPDFQVFVYNKNDDLQHFPTYKELRSMFSSLDYKFEFLSE
IEDDDDWETNSYVEDIPRKEYIHKRSAKSQTEKSESSMKASFQKKTAQSS
TKKKRKAYPPHIQQNRRLKTGYRSFIIAIMDNGLISFVKMSEADFGSESV
WYTPNTQKKVDQRWKKH

TRNA-splicing endonuclease subunit SEN54 (Saccharomyces cerevisiae) is product of expression of SEN54 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. Nature 1997-05-01 (387) 9169875
The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases. Trotta CR, Miao F, Arn EA, Stevens SW, Ho CK, Rauhut R, Abelson JN Cell 1997-06-13 (89) 9200603
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Possibility of cytoplasmic pre-tRNA splicing: the yeast tRNA splicing endonuclease mainly localizes on the mitochondria. Yoshihisa T, Yunoki-Esaki K, Ohshima C, Tanaka N, Endo T Mol Biol Cell 2003-08-01 (14) 12925762



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.