Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

tRNA-splicing endonuclease subunit SEN34

 
Known also as: Splicing endonuclease of 34 kDa, tRNA-intron endonuclease SEN34

Known abbreviations: SEN34, YAR008W, FUN4

 

FUNCTION:
 
Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. It probably carries the active site for 3'-splice site cleavage.
 
CATALYTIC ACTIVITY:
 
Endonucleolytic cleavage of pre-tRNA, producing 5'-hydroxy and 2',3'-cyclic phosphate termini, and specifically removing the intron.
 
SUBUNIT STRUCTURE:
 
Heterotetramer composed of SEN2, SEN15, SEN34 and SEN54. Interacts directly with SEN15. 
 
CELLULAR LOCALIZATION:
 
Nucleus. Endomembrane system; Peripheral membrane protein. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side. Note: The tRNA splicing endonuclease complex is predominantly associated with the outer membrane of mitochondria, suggesting that tRNA splicing mainly takes place on the mitochondrial surface. 



This protein can be a part of a given complexes: Activities in which tRNA-splicing endonuclease subunit SEN34 is involved: Pathways in which tRNA-splicing endonuclease subunit SEN34 is involved:

NCBI GI number(s): 6319322
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P39707 P39707
BRENDA - -
KEGG sce:YAR008W sce:YAR008W
PFAM: PF01974
PF01974
InterPro: IPR011856
IPR006677
IPR006676
IPR016690
IPR011856
IPR006677
IPR006676
IPR016690
CATH: - -
SCOP: - -


Protein sequence:
MPPLVFDIDHIKLLRKWGICGVLSGTLPTAAQQNVFLSVPLRLMLEDVLW
LHLNNLADVKLIRQEGDEIMEGITLERGAKLSKIVNDRLNKSFEYQRKFK
KDEHIAKLKKIGRINDKTTAEELQRLDKSSNNDQLIESSLFIDIANTSMI
LRDIRSDSDSLSRDDISDLLFKQYRQAGKMQTYFLYKALRDQGYVLSPGG
RFGGKFIAYPGDPLRFHSHLTIQDAIDYHNEPIDLISMISGARLGTTVKK
LWVIGGVAEETKETHFFSIEWAGFG

TRNA-splicing endonuclease subunit SEN34 (Saccharomyces cerevisiae) is product of expression of SEN34 gene.

TRNA-splicing endonuclease subunit SEN34 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of chromosome I from Saccharomyces cerevisiae. Bussey H, Kaback DB, Zhong W, Vo DT, Clark MW, Fortin N, Hall J, Ouellette BF, Keng T, Barton AB, et al. Proc Natl Acad Sci U S A 1995-04-25 (92) 7731988
The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases. Trotta CR, Miao F, Arn EA, Stevens SW, Ho CK, Rauhut R, Abelson JN Cell 1997-06-13 (89) 9200603
Sequencing of chromosome I of Saccharomyces cerevisiae: analysis of the 42 kbp SPO7-CENI-CDC15 region. Clark MW, Keng T, Storms RK, Zhong W, Fortin N, Zeng B, Delaney S, Ouellette BF, Barton AB, Kaback DB, et al. Yeast 1994-04-01 (10) 7941740
Possibility of cytoplasmic pre-tRNA splicing: the yeast tRNA splicing endonuclease mainly localizes on the mitochondria. Yoshihisa T, Yunoki-Esaki K, Ohshima C, Tanaka N, Endo T Mol Biol Cell 2003-08-01 (14) 12925762



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.