Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

PAB-dependent poly(A)-specific ribonuclease subunit 2

 
Known also as: Inactive ubiquitin carboxyl-terminal hydrolase 52

Known abbreviations: PAN2, KIAA0710, USP52

 

FUNCTION:
 
Functions in cytoplasmic mRNA decay. As part of the Pan nuclease complex, shortens poly(A) tails of RNA when the poly(A) stretch is bound by polyadenylate-binding protein. 
 
CATALYTIC ACTIVITY:
 
Exonucleolytic cleavage of poly(A) to 5'-AMP. 
 
SUBUNIT STRUCTURE:
 
Interacts with PAN3 to form the Pan nuclease complex which in turn interacts with the polyadenylate-binding protein through PAN3. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm. Nucleus. Note: Shuttles between nucleus and cytoplasm. 



This protein can be a part of a given complexes: Activities in which PAB-dependent poly(A)-specific ribonuclease subunit 2 is involved: Pathways in which PAB-dependent poly(A)-specific ribonuclease subunit 2 is involved:

NCBI GI number(s): 261878447
188536112
261878448
261878449
261878450
188536114
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q504Q3 Q504Q3
BRENDA - -
KEGG hsa:9924 hsa:9924
PFAM: PF00929
PF00929
InterPro: IPR006055
IPR013520
IPR001394
IPR012337
IPR015943
IPR017986
IPR006055
IPR013520
IPR001394
IPR012337
IPR015943
IPR017986
CATH: - -
SCOP: - -


Protein sequence:
MNFEGLDPGLAEYAPAMHSALDPVLDAHLNPSLLQNVELDPEGVALEALP
VQESVHIMEGVYSELHSVVAEVGVPVSVSHFDLHEEMLWVGSHGGHATSF
FGPALERYSSFQVNGSDDIRQIQSLENGILFLTKNNLKYMARGGLIIFDY
LLDENEDMHSLLLTDSSTLLVGGLQNHIIEIDLNTVQETQKYAVETPGVT
IMRQTNRFFFCGHTSGKVSLRDLRTFKVEHEFDAFSGSLSDFDVHGNLLA
ACGFSSRLTGLACDRFLKVYDLRMMRAITPLQVHVDPAFLRFIPTYTSRL
AIISQSGQCQFCEPTGLANPADIFHVNPVGPLLMTFDVSASKQALAFGDS
EGCVHLWTDSPEPSFNPYSRETEFALPCLVDSLPPLDWSQDLLPLSLIPV
PLTTDTLLSDWPAANSAPAPRRAPPVDAEILRTMKKVGFIGYAPNPRTRL
RNQIPYRLKESDSEFDSFSQVTESPVGREEEPHLHMVSKKYRKVTIKYSK
LGLEDFDFKHYNKTLFAGLEPHIPNAYCNCMIQVLYFLEPVRCLIQNHLC
QKEFCLACELGFLFHMLDLSRGDPCQGNNFLRAFRTIPEASALGLILADS
DEASGKGNLARLIQRWNRFILTQLHQDMQELEIPQAYRGAGGSSFCSSGD
SVIGQLFSCEMENCSLCRCGSETVRASSTLLFTLSYPDGSKSDKTGKNYD
FAQVLKRSICLDQNTQAWCDTCEKYQPTIQTRNIRHLPDILVINCEVNSS
KEADFWRMQAEVAFKMAVKKHGGEISKNKEFALADWKELGSPEGVLVCPS
IEELKNVWLPFSIRMKMTKNKGLDVCNWTDGDEMQWGPARAEEEHGVYVY
DLMATVVHILDSRTGGSLVAHIKVGETYHQRKEGVTHQQWYLFNDFLIEP
IDKHEAVQFDMNWKVPAILYYVKRNLNSRYNLNIKNPIEASVLLAEASLA
RKQRKTHTTFIPLMLNEMPQIGDLVGLDAEFVTLNEEEAELRSDGTKSTI
KPSQMSVARITCVRGQGPNEGIPFIDDYISTQEQVVDYLTQYSGIKPGDL
DAKISSKHLTTLKSTYLKLRFLIDIGVKFVGHGLQKDFRVINLMVPKDQV
LDTVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKY
LELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVL
AL

PAB-dependent poly(A)-specific ribonuclease subunit 2 (Homo sapiens) is product of expression of PAN2 gene.

PAB-dependent poly(A)-specific ribonuclease subunit 2 (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP Nat Biotechnol 2006-10-01 (24) 16964243
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem 2009-06-01 (81) 19413330
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
A quantitative atlas of mitotic phosphorylation. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP Proc Natl Acad Sci U S A 2008-08-05 (105) 18669648
Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. Ishikawa K, Nagase T, Suyama M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O DNA Res 1998-06-01 (5) 9734811
The consensus coding sequences of human breast and colorectal cancers. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE Science 2006-10-13 (314) 16959974
Identification of a human cytoplasmic poly(A) nuclease complex stimulated by poly(A)-binding protein. Uchida N, Hoshino S, Katada T J Biol Chem 2004-02-09 (279) 14583602
Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases. Quesada V, Diaz-Perales A, Gutierrez-Fernandez A, Garabaya C, Cal S, Lopez-Otin C Biochem Biophys Res Commun 2004-02-01 (314) 14715245
Concerted action of poly(A) nucleases and decapping enzyme in mammalian mRNA turnover. Yamashita A, Chang TC, Yamashita Y, Zhu W, Zhong Z, Chen CY, Shyu AB Nat Struct Mol Biol 2005-12-01 (12) 16284618



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.