Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

PAB-dependent poly(A)-specific ribonuclease subunit 3

 
Known abbreviations: PAN3

 

FUNCTION:
 
Functions in cytoplasmic mRNA decay. As part of the Pan nuclease complex, recruits polyadenylate-binding protein which in turn stimulates PAN2 nuclease activity. 
 
SUBUNIT STRUCTURE:
 
Interacts with PAN2 to form the Pan nuclease complex. Mediates the interaction of the Pan nuclease complex with polyadenylate-binding protein. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm.
 
DOMAIN:
 
The protein kinase domain is predicted to be catalytically inactive.



This protein can be a part of a given complexes: Activities in which PAB-dependent poly(A)-specific ribonuclease subunit 3 is involved: Pathways in which PAB-dependent poly(A)-specific ribonuclease subunit 3 is involved:

NCBI GI number(s): 281427224
281427223
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q58A45 Q58A45
BRENDA - -
KEGG hsa:255967 hsa:255967
PFAM: - Q58A45 (Link - using uniprot id)
InterPro: IPR011009
IPR000719
IPR000571
IPR011009
IPR000719
IPR000571
CATH: - -
SCOP: - -


Protein sequence:
MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAVGVKLKYCR
YYAKDKTCFYGEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPVAGFPP
GAVAGGGAGPPPGPKKPDLGDPGTGAAAGGGGSSGGLDGPRLAIPGMDGG
ALTDTSLTDSYFSTSFIGVNGFGSPVETKYPLMQRMTNSSSSPSLLNDSA
KPYSAHDPLTSPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKA
RKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGST
SRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKIT
PHTSPAPRRRSHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGG
TTYFYTDTTPAPLTGMVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELR
QELINRHLITMAQIDQADMPAVPTEVDSYHSLFPLEPLPPPNRIQKSSNF
GYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKIQHSNIVT
LREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQH
EGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITG
KTRLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACN
SLAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIG
ARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDP
TWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKI
SLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL

PAB-dependent poly(A)-specific ribonuclease subunit 3 (Homo sapiens) is product of expression of PAN3 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
The DNA sequence and analysis of human chromosome 13. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S Nature 2004-04-01 (428) 15057823
The full-ORF clone resource of the German cDNA Consortium. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I BMC Genomics 2007-01-01 (8) 17974005
Identification of a human cytoplasmic poly(A) nuclease complex stimulated by poly(A)-binding protein. Uchida N, Hoshino S, Katada T J Biol Chem 2004-02-09 (279) 14583602



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.