Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

CCR4-NOT transcription complex subunit 4

 
Known also as: CCR4-associated factor 4, E3 ubiquitin-protein ligase CNOT4, Potential transcriptional repressor NOT4Hp

Known abbreviations: CNOT4, NOT4

 

FUNCTION:
 
Has E3 ubiquitin ligase activity. The CCR4-NOT complex functions as general transcription regulation complex. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm (Probable.) Nucleus (Probable.)
 
POST-TRANSLATIONAL MODIFICATION:
 
Autoubiquitinated.
Phosphorylated upon DNA damage, probably by ATM or ATR. 



This protein can be a part of a given complexes: Activities in which CCR4-NOT transcription complex subunit 4 is involved: Pathways in which CCR4-NOT transcription complex subunit 4 is involved:

NCBI GI number(s): 56550059
300069009
300069011
300069010
300069013
300069012
300069017
300069016
56550057
300069008
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot O95628 O95628
BRENDA - -
KEGG hsa:4850 hsa:4850
PFAM: - O95628 (Link - using uniprot id)
InterPro: IPR012677
IPR000504
IPR000571
IPR001841
IPR013083
IPR012677
IPR000504
IPR000571
IPR001841
IPR013083
CATH: - -
SCOP: - -
Solved crystal structures: 1E4U
1UR6
[PDB] [details]
[PDB] [details]


Protein sequence:
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDEN
GLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHL
ASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYA
GSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFL
KNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPN
FLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTP
SPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSG
LPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPE
DDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPG
SGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPW
MAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVS
TMPLSTSSHSLQQGQQPTSLHTTVA

CCR4-NOT transcription complex subunit 4 (Homo sapiens) is product of expression of CNOT4 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits. Albert TK, Lemaire M, van Berkum NL, Gentz R, Collart MA, Timmers HT Nucleic Acids Res 2000-01-01 (28) 10637334
An altered-specificity ubiquitin-conjugating enzyme/ubiquitin-protein ligase pair. Winkler GS, Albert TK, Dominguez C, Legtenberg YI, Boelens R, Timmers HT J Mol Biol 2004-03-12 (337) 15001359
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ Science 2007-05-25 (316) 17525332
A quantitative atlas of mitotic phosphorylation. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP Proc Natl Acad Sci U S A 2008-08-05 (105) 18669648
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK Sci Signal 2009-01-01 (2) 19690332
The DNA sequence of human chromosome 7. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R Nature 2003-07-10 (424) 12853948
Identification of a ubiquitin-protein ligase subunit within the CCR4-NOT transcription repressor complex. Albert TK, Hanzawa H, Legtenberg YI, de Ruwe MJ, van den Heuvel FA, Collart MA, Boelens R, Timmers HT EMBO J 2002-01-01 (21) 11823428
The structure of the C4C4 ring finger of human NOT4 reveals features distinct from those of C3HC4 RING fingers. Hanzawa H, de Ruwe MJ, Albert TK, van Der Vliet PC, Timmers HT, Boelens R J Biol Chem 2001-03-01 (276) 11087754



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.