Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

CCR4-NOT transcription complex subunit 10

 
Known abbreviations: CNOT10


This protein can be a part of a given complexes: Activities in which CCR4-NOT transcription complex subunit 10 is involved: Pathways in which CCR4-NOT transcription complex subunit 10 is involved:

NCBI GI number(s): 376319247
376319246
13123772
376319245
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9H9A5 Q9H9A5
BRENDA - -
KEGG hsa:25904 hsa:25904
PFAM: PF00515
PF00515
InterPro: IPR001440
IPR011990
IPR019734.
IPR001440
IPR011990
IPR019734.
CATH: - -
SCOP: - -


Protein sequence:
MAADKPADQGAEKHEGTGQSSGITDQEKELSTNAFQAFTSGNYDACLQHL
ACLQDINKDDYKIILNTAVAEFFKSNQTTTDNLRQTLNQLKNQVHSAVEE
MDGLDDVENSMLYYNQAVILYHLRQYTEAISVGEKLYQFIEPFEEKFAQA
VCFLLVDLYILTYQAEKALHLLAVLEKMISQGNNNKNGKNETGNNNNKDG
SNHKAESGALIEAAKSKIHQYKVRAYIQMKSLKACKREIKSVMNTAGNSA
PSLFLKSNFEYLRGNYRKAVKLLNSSNIAEHPGFMKTGECLRCMFWNNLG
CIHFAMSKHNLGIFYFKKALQENDNVCAQLSAGSTDPGKKFSGRPMCTLL
TNKRYELLYNCGIQLLHIGRPLAAFECLIEAVQVYHANPRLWLRLAECCI
AANKGTSEQETKGLPSKKGIVQSIVGQGYHRKIVLASQSIQNTVYNDGQS
SAIPVASMEFAAICLRNALLLLPEEQQDPKQENGAKNSNQLGGNTESSES
SETCSSKSHDGDKFIPAPPSSPLRKQELENLKCSILACSAYVALALGDNL
MALNHADKLLQQPKLSGSLKFLGHLYAAEALISLDRISDAITHLNPENVT
DVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLFNLG
SAYCLRSEYDKARKCLHQAASMIHPKEVPPEAILLAVYLELQNGNTQLAL
QIIKRNQLLPAVKTHSEVRKKPVFQPVHPIQPIQMPAFTTVQRK

CCR4-NOT transcription complex subunit 10 (Homo sapiens) is product of expression of CNOT10 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem 2009-06-01 (81) 19413330
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
The full-ORF clone resource of the German cDNA Consortium. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I BMC Genomics 2007-01-01 (8) 17974005



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.