Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

General negative regulator of transcription subunit 5

 
Known abbreviations: NOT5

FUNCTION:

Acts as component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover. The NOT protein subcomplex negatively regulates the basal and activated transcription of many genes. Preferentially affects TC-type TATA element-dependent transcription. Could directly or indirectly inhibit component(s) of the general transcription machinery.

SUBUNIT: 

Forms a NOT protein complex that comprises NOT1, NOT2, NOT3, NOT4 and NOT5. Subunit of the 1.0 MDa CCR4-NOT core complex that contains CCR4, CAF1, NOT1, NOT2, NOT3, NOT4, NOT5, CAF40 and CAF130. In the complex interacts with NOT1 and NOT2. The core complex probably is part of a less characterized 1.9 MDa CCR4-NOT complex.

SUBCELLULAR LOCATION:

Cytoplasm (Probable). Nucleus.
 




This protein can be a part of a given complexes: Activities in which General negative regulator of transcription subunit 5 is involved: Pathways in which General negative regulator of transcription subunit 5 is involved:

NCBI GI number(s): 2497232
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q12514 Q12514
BRENDA - -
KEGG sce:YPR072W sce:YPR072W
PFAM: - Q12514 (Link - using uniprot id)
InterPro: IPR012270
IPR007282
IPR007207
IPR012270
IPR007282
IPR007207
CATH: - -
SCOP: - -


Protein sequence:
MSQRKLQQDIDKLLKKVKEGIEDFDDIYEKFQSTDPSNSSHREKLESDLK
REIKKLQKHRDQIKTWLSKEDVKDKQSVLMTNRRLIENGMERFKSVEKLM
KTKQFSKEALTNPDIIKDPKELKKRDQVLFIHDCLDELQKQLEQYEAQEN
EEQTERHEFHIANLENILKKLQNNEMDPEPVEEFQDDIKYYVENNDDPDF
IEYDTIYEDMGCEIQPSSSNNEAPKEGNNQTSLSSIRSSKKQERSPKKKA
PQRDVSISDRATTPIAPGVESASQSISSTPTPVSTDTPLHTVKDDSIKFD
NSTLGTPTTHVSMKKKESENDSEQQLNFPPDRTDEIRKTIQHDVETNAAF
QNPLFNDELKYWLDSKRYLMQPLQEMSPKMVSQLESSLLNCPDSLDADSP
CLYTKPLSLPHPTSIFFPNEPIRFVYPYDVPLNLTNNENDTDNKFGKDSK
AKSKKDDDIYSRTSLARIFMKFDLDTLFFIFYHYQGSYEQFLAARELFKN
RNWLFNKVDRCWYYKEIEKLPPGMGKSEEESWRYFDYKKSWLARRCGNDF
VYNEEDFEKL

General negative regulator of transcription subunit 5 (Saccharomyces cerevisiae) is product of expression of NOT5 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. Nature 1997-05-01 (387) 9169875
Purification and characterization of the 1.0 MDa CCR4-NOT complex identifies two novel components of the complex. Chen J, Rappsilber J, Chiang YC, Russell P, Mann M, Denis CL J Mol Biol 2001-12-07 (314) 11733989
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res 2007-03-01 (6) 17330950
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF Proc Natl Acad Sci U S A 2007-01-13 (104) 17287358
Characterization of NOT5 that encodes a new component of the Not protein complex. Oberholzer U, Collart MA Gene 1998-02-19 (207) 9511744
The NOT proteins are part of the CCR4 transcriptional complex and affect gene expression both positively and negatively. Liu HY, Badarinarayana V, Audino DC, Rappsilber J, Mann M, Denis CL EMBO J 1998-01-16 (17) 9463387
The CCR4 and CAF1 proteins of the CCR4-NOT complex are physically and functionally separated from NOT2, NOT4, and NOT5. Bai Y, Salvadore C, Chiang YC, Collart MA, Liu HY, Denis CL Mol Cell Biol 1999-10-01 (19) 10490603
Characterization of mutations in NOT2 indicates that it plays an important role in maintaining the integrity of the CCR4-NOT complex. Russell P, Benson JD, Denis CL J Mol Biol 2002-09-06 (322) 12215412



Add your own comment!


There are no comments yet.

Entry added on: 2010-04-12 22:44:44, by a user: kaja

Welcome stranger! Click here to login or here to register.