RNApathwaysDB - a database of RNA maturation and decay.

MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMF
PHRSEKDMLASPSTSGQLSQFGASLYGQQSALGLPMRGMSNNTPQLNRSL
SQGTQLPSHVTPTTGVPTMSLHTPPSPSRGILPMNPRNMMNHSQVGQGIG
IPSRTNSMSSSGLGSPNRSSPSIICMPKQQPSRQPFTVNSMSGFGMNRNQ
AFGMNNSLSSNIFNGTDGSENVTGLDLSDFPALADRNRREGSGNPTPLIN
PLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS
NLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLPDGRVTNIPQGM
VTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFA
SPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYM
NGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYY
FFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF

CCR4-NOT transcription complex subunit 2 (Homo sapiens) is product of expression of CNOT2 gene.

References:

Title	Authors	Journal	Publication date (Issue)	PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).	Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K	Genome Res	2004-10-01 (14)	15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs.	Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K	Nat Genet	2004-02-01 (36)	14702039
Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits.	Albert TK, Lemaire M, van Berkum NL, Gentz R, Collart MA, Timmers HT	Nucleic Acids Res	2000-01-01 (28)	10637334
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.	Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S	Anal Chem	2009-06-01 (81)	19413330
Initial characterization of the human central proteome.	Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J	BMC Syst Biol	2011-01-01 (5)	21269460
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.	Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ	Science	2007-05-25 (316)	17525332
The full-ORF clone resource of the German cDNA Consortium.	Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I	BMC Genomics	2007-01-01 (8)	17974005
A quantitative atlas of mitotic phosphorylation.	Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP	Proc Natl Acad Sci U S A	2008-08-05 (105)	18669648
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.	Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK	Sci Signal	2009-01-01 (2)	19690332
Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.	Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M	Mol Cell	2008-08-08 (31)	18691976
Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.	Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z	Genome Res	2000-10-01 (10)	11042152

Add your own comment!

There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.