|
Known also as: CCR4-associated factor 2
Known abbreviations: CNOT2, CDC36, NOT2, HSPC131, MSTP046
FUNCTION:
The CCR4-NOT complex functions as general transcription regulation complex.
CELLULAR LOCALIZATION:
Cytoplasm (Probable.) Nucleus (Probable.)
TISSUE SPECIFICITY:
Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocytes.
POST-TRANSLATIONAL MODIFICATION:
Phosphorylated upon DNA damage, probably by ATM or ATR.
|
This protein can be a part of a given complexes:
Activities in which CCR4-NOT transcription complex subunit 2 is involved:
Pathways in which CCR4-NOT transcription complex subunit 2 is involved:
Links to other databases:
Protein sequence:
MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMF
PHRSEKDMLASPSTSGQLSQFGASLYGQQSALGLPMRGMSNNTPQLNRSL
SQGTQLPSHVTPTTGVPTMSLHTPPSPSRGILPMNPRNMMNHSQVGQGIG
IPSRTNSMSSSGLGSPNRSSPSIICMPKQQPSRQPFTVNSMSGFGMNRNQ
AFGMNNSLSSNIFNGTDGSENVTGLDLSDFPALADRNRREGSGNPTPLIN
PLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS
NLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLPDGRVTNIPQGM
VTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFA
SPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYM
NGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYY
FFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF
|
CCR4-NOT transcription complex subunit 2 (Homo sapiens) is product of expression of
CNOT2
gene.
References:
Title |
Authors |
Journal
| Publication date (Issue)
| PubMed ID
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K |
Genome Res
|
2004-10-01 (14) |
15489334 |
Complete sequencing and characterization of 21,243 full-length human cDNAs. |
Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K |
Nat Genet
|
2004-02-01 (36) |
14702039 |
Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits. |
Albert TK, Lemaire M, van Berkum NL, Gentz R, Collart MA, Timmers HT |
Nucleic Acids Res
|
2000-01-01 (28) |
10637334 |
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. |
Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S |
Anal Chem
|
2009-06-01 (81) |
19413330 |
Initial characterization of the human central proteome. |
Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J |
BMC Syst Biol
|
2011-01-01 (5) |
21269460 |
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. |
Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ |
Science
|
2007-05-25 (316) |
17525332 |
The full-ORF clone resource of the German cDNA Consortium. |
Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I |
BMC Genomics
|
2007-01-01 (8) |
17974005 |
A quantitative atlas of mitotic phosphorylation. |
Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP |
Proc Natl Acad Sci U S A
|
2008-08-05 (105) |
18669648 |
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. |
Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK |
Sci Signal
|
2009-01-01 (2) |
19690332 |
Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. |
Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M |
Mol Cell
|
2008-08-08 (31) |
18691976 |
Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. |
Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z |
Genome Res
|
2000-10-01 (10) |
11042152 |
Add your own comment!
There are no comments yet.
Last modification of this entry: Sept. 25, 2012.
|