Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Cell differentiation protein RCD1 homolog

 
Known also as: CCR4-NOT transcription complex subunit 9

Known abbreviations: RQCD1, CNOT9, RCD1

 

FUNCTION:
 
Transcription factor that down-regulates MYB- and JUN-dependent transcription. May play a role in cell differentiation By similarity. Can bind oligonucleotides, such as poly-G, poly-C or poly-T (in vitro), but the physiological relevance of this is not certain. Does not bind poly-A. 
 
SUBUNIT STRUCTURE:
 
Homodimer. Interacts with MYB, ATF2, RARA, RARB, RARG, RXRA, RXRB and RXRG. Identified in a complex with ATF2 bound to target DNA By similarity. Interacts with NANOS2 By similarity. 
 
CELLULAR LOCALIZATION:
 
Nucleus (By similarity.) Cytoplasm › P-body (By similarity.) Note: NANOS2 promotes its localization to P-body (By similarity.)
 
TISSUE SPECIFICITY:
 
Detected in spleen, thymus, prostate, testis, ovary and intestine. 



This protein can be a part of a given complexes: Activities in which Cell differentiation protein RCD1 homolog is involved: Pathways in which Cell differentiation protein RCD1 homolog is involved:

NCBI GI number(s): 4885579
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q92600 Q92600
BRENDA - -
KEGG hsa:9125 hsa:9125
PFAM: PF04078
PF04078
InterPro: IPR011989
IPR016024
IPR007216
IPR011989
IPR016024
IPR007216
CATH: - -
SCOP: - -
Solved crystal structures: 2FV2
[PDB] [details]


Protein sequence:
MHSLATAAPVPTTLAQVDREKIYQWINELSSPETRENALLELSKKRESVP
DLAPMLWHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCV
ASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGALVKTD
EQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYIC
QTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNPRAREALR
QCLPDQLKDTTFAQVLKDDTTTKRWLAQLVKNLQEGQVTDPRGIPLPPQ

Cell differentiation protein RCD1 homolog (Homo sapiens) is product of expression of RQCD1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Novel factor highly conserved among eukaryotes controls sexual development in fission yeast. Okazaki N, Okazaki K, Watanabe Y, Kato-Hayashi M, Yamamoto M, Okayama H Mol Cell Biol 1998-01-01 (18) 9447985
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem 2009-06-01 (81) 19413330
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Atomic model of human Rcd-1 reveals an armadillo-like-repeat protein with in vitro nucleic acid binding properties. Garces RG, Gillon W, Pai EF Protein Sci 2007-01-01 (16) 17189474



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.