Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

UPF0760 protein C2orf29

 
Known abbreviations: C2orf29


This protein can be a part of a given complexes: Activities in which UPF0760 protein C2orf29 is involved: Pathways in which UPF0760 protein C2orf29 is involved:

NCBI GI number(s): 188497630
188497629
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9UKZ1 Q9UKZ1
BRENDA - -
KEGG hsa:55571 hsa:55571
PFAM: PF10155
PF10155
InterPro: IPR019312
IPR019312
CATH: - -
SCOP: - -


Protein sequence:
MPGGGASAASGRLLTAAEQRGSREAAGSASRSGFGGSGGGRGGASGPGSG
SGGPGGPAGRMSLTPKELSSLLSIISEEAGGGSTFEGLSTAFHHYFSKAD
HFRLGSVLVMLLQQPDLLPSAAQRLTALYLLWEMYRTEPLAANPFAASFA
HLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAPPRELFKKT
PRQIALMDVGNMGQSVDISGLQLALAERQSELPTQSKASFPSILSDPDPD
SSNSGFDSSVASQITEALVSGPKPPIESHFRPEFIRPPPPLHICEDELAW
LNPTEPDHAIQWDKSMCVKNSTGVEIKRIMAKAFKSPLSSPQQTQLLGEL
EKDPKLVYHIGLTPAKLPDLVENNPLVAIEMLLKLMQSSQITEYFSVLVN
MDMSLHSMEVVNRLTTAVDLPPEFIHLYISNCISTCEQIKDKYMQNRLVR
LVCVFLQSLIRNKIINVQDLFIEVQAFCIEFSRIREAAGLFRLLKTLDTG
ETPSETKMSK

UPF0760 protein C2orf29 (Homo sapiens) is product of expression of C2orf29 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Identification of differentially expressed genes associated with HER-2/neu overexpression in human breast cancer cells. Oh JJ, Grosshans DR, Wong SG, Slamon DJ Nucleic Acids Res 1999-10-15 (27) 10497265
Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M Nature 2005-04-07 (434) 15815621
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.