Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

CCR4-NOT transcription complex subunit 7

 
Known also as: BTG1-binding factor 1, CCR4-associated factor 1

Known abbreviations: CNOT7, CAF1

 

FUNCTION:
 
Ubiquitous transcription factor required for a diverse set of processes. It is a component of the CCR4 complex involved in the control of gene expression (By similarity.)
 
SUBUNIT STRUCTURE:
 
Interacts with TOB1. Interacts with NANOS2 (By similarity.)
 
CELLULAR LOCALIZATION:
 
Nucleus. Cytoplasm › P-body (By similarity.) Note: NANOS2 promotes its localization to P-body (By similarity.)



This protein can be a part of a given complexes: Activities in which CCR4-NOT transcription complex subunit 7 is involved: Pathways in which CCR4-NOT transcription complex subunit 7 is involved:

NCBI GI number(s): 85067507
85067506
85067505
85067504
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9UIV1 Q9UIV1
BRENDA - -
KEGG hsa:29883 hsa:29883
PFAM: PF04857
PF04857
InterPro: IPR006941
IPR012337
IPR006941
IPR012337
CATH: - -
SCOP: - -
Solved crystal structures: 2D5R
[PDB] [details]


Protein sequence:
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARP
IGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFK
FNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEG
VKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMK
SCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHI
DDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS

CCR4-NOT transcription complex subunit 7 (Homo sapiens) is product of expression of CNOT7 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Human carbon catabolite repressor protein (CCR4)-associative factor 1: cloning, expression and characterization of its interaction with the B-cell translocation protein BTG1. Bogdan JA, Adams-Burton C, Pedicord DL, Sukovich DA, Benfield PA, Corjay MH, Stoltenborg JK, Dicker IB Biochem J 1998-12-01 (None) 9820826
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
DNA sequence and analysis of human chromosome 8. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA Nature 2006-02-19 (439) 16421571



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.