Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

CCR4-NOT transcription complex subunit 6-like

 
Known also as: Carbon catabolite repressor protein 4 homolog B

Known abbreviations: CNOT6L, CCR4B

 

FUNCTION:
 
Plays a role in the deadenylation of mRNAs in the cytoplasm. Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. May be involved in the deadenylation-dependent degradation of mRNAs through the 3'-UTR AU-rich element-mediated mechanism. Involved in deadenylation-dependent degradation of CDKN1B mRNA. 
 
COFACTOR:
 
Magnesium. 
 
SUBUNIT STRUCTURE:
 
Component of the CCR4-NOT complex at least composed of CNOT1, CNOT2, CNOT3, CNOT8, CNOT9, CNOT10 and TNKS1BP1. Interacts with NANOS2 (By similarity.)
 
CELLULAR LOCALIZATION:
 
Cytoplasm 
 
TISSUE SPECIFICITY:
 
Highly expressed in placenta, skeletal muscle, pancreas, testis and leukocytes. Weakly expressed in heart, spleen and thymus. 



This protein can be a part of a given complexes: Activities in which CCR4-NOT transcription complex subunit 6-like is involved: Pathways in which CCR4-NOT transcription complex subunit 6-like is involved:

NCBI GI number(s): 115583678
115583679
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q96LI5 Q96LI5
BRENDA - -
KEGG hsa:246175 hsa:246175
PFAM: PF03372
PF03372
InterPro: IPR005135
IPR001611
IPR005135
IPR001611
CATH: - -
SCOP: - -
Solved crystal structures: 3NGN
3NGO
3NGQ
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MRLIGMPKEKYDPPDPRRIYTIMSAEEVANGKKSHWAELEISGRVRSLST
SLWSLTHLTALHLNDNYLSRIPPDIAKLHNLVYLDLSSNKLRSLPAELGN
MVSLRELLLNNNLLRVLPYELGRLFQLQTLGLKGNPLSQDILNLYQDPDG
TRKLLNFMLDNLAVHPEQLPPRPWITLKERDQILPSASFTVMCYNVLCDK
YATRQLYGYCPSWALNWEYRKKGIMEEIVNCDADIISLQEVETEQYFTLF
LPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTV
EFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAAD
KQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADP
NSIPLVLCADLNSLPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCN
GKNGSSEGRITHGFQLKSAYENNLMPYTNYTFDFKGVIDYIFYSKTHMNV
LGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQLELHPPLLPLVNGVH
LPNRR

CCR4-NOT transcription complex subunit 6-like (Homo sapiens) is product of expression of CNOT6L gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Depletion of mammalian CCR4b deadenylase triggers elevation of the p27Kip1 mRNA level and impairs cell growth. Morita M, Suzuki T, Nakamura T, Yokoyama K, Miyasaka T, Yamamoto T Mol Cell Biol 2007-07-01 (27) 17452450
Crystal structure of the human CNOT6L nuclease domain reveals strict poly(A) substrate specificity. Wang H, Morita M, Yang X, Suzuki T, Yang W, Wang J, Ito K, Wang Q, Zhao C, Bartlam M, Yamamoto T, Rao Z EMBO J 2010-08-04 (29) 20628353
Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M Nature 2005-04-07 (434) 15815621
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
The full-ORF clone resource of the German cDNA Consortium. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I BMC Genomics 2007-01-01 (8) 17974005



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.