|
Known also as: CAF1-like protein, CAF2, CCR4-associated factor 8
Known abbreviations: CNOT8, CALIF, POP2
FUNCTION:
Ubiquitous transcription factor required for a diverse set of processes. The CCR4-NOT complex functions as general transcription regulation complex.
CELLULAR LOCALIZATION:
Cytoplasm. Nucleus
|
This protein can be a part of a given complexes:
Activities in which CCR4-NOT transcription complex subunit 8 is involved:
Pathways in which CCR4-NOT transcription complex subunit 8 is involved:
Links to other databases:
Protein sequence:
MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRP
IGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFK
FNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDN
VKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMK
SCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSI
DDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
|
CCR4-NOT transcription complex subunit 8 (Homo sapiens) is product of expression of
CNOT8
gene.
References:
Title |
Authors |
Journal
| Publication date (Issue)
| PubMed ID
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K |
Genome Res
|
2004-10-01 (14) |
15489334 |
Complete sequencing and characterization of 21,243 full-length human cDNAs. |
Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K |
Nat Genet
|
2004-02-01 (36) |
14702039 |
The human POP2 gene: identification, sequencing, and mapping to the critical region of the 5q- syndrome. |
Fidler C, Wainscoat JS, Boultwood J |
Genomics
|
1999-01-15 (56) |
10036195 |
Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits. |
Albert TK, Lemaire M, van Berkum NL, Gentz R, Collart MA, Timmers HT |
Nucleic Acids Res
|
2000-01-01 (28) |
10637334 |
Initial characterization of the human central proteome. |
Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J |
BMC Syst Biol
|
2011-01-01 (5) |
21269460 |
Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. |
Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A |
Genome Res
|
2001-03-01 (11) |
11230166 |
BTG2 antiproliferative protein interacts with the human CCR4 complex existing in vivo in three cell-cycle-regulated forms. |
Morel AP, Sentis S, Bianchin C, Le Romancer M, Jonard L, Rostan MC, Rimokh R, Corbo L |
J Cell Sci
|
2003-07-15 (116) |
12771185 |
Add your own comment!
There are no comments yet.
Last modification of this entry: Sept. 25, 2012.
|