Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

CCR4-NOT transcription complex subunit 8
 
Known also as: CAF1-like protein, CAF2, CCR4-associated factor 8

Known abbreviations: CNOT8, CALIF, POP2

 

FUNCTION:
 
Ubiquitous transcription factor required for a diverse set of processes. The CCR4-NOT complex functions as general transcription regulation complex. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm. Nucleus 


This protein can be a part of a given complexes: Activities in which CCR4-NOT transcription complex subunit 8 is involved: Pathways in which CCR4-NOT transcription complex subunit 8 is involved:
NCBI GI number(s): 31542314
31542315
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9UFF9 Q9UFF9
BRENDA - -
KEGG hsa:9337 hsa:9337
PFAM: PF04857
PF04857
InterPro: IPR006941
IPR012337
 IPR006941
IPR012337
CATH: - -
SCOP: - -


Protein sequence:
MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRP
IGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFK
FNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDN
VKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMK
SCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSI
DDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ

CCR4-NOT transcription complex subunit 8 (Homo sapiens) is product of expression of CNOT8 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
The human POP2 gene: identification, sequencing, and mapping to the critical region of the 5q- syndrome. Fidler C, Wainscoat JS, Boultwood J Genomics 1999-01-15 (56) 10036195
Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits. Albert TK, Lemaire M, van Berkum NL, Gentz R, Collart MA, Timmers HT Nucleic Acids Res 2000-01-01 (28) 10637334
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A Genome Res 2001-03-01 (11) 11230166
BTG2 antiproliferative protein interacts with the human CCR4 complex existing in vivo in three cell-cycle-regulated forms. Morel AP, Sentis S, Bianchin C, Le Romancer M, Jonard L, Rostan MC, Rimokh R, Corbo L J Cell Sci 2003-07-15 (116) 12771185


Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.
Welcome stranger! Click here to login or here to register.