Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

U6 snRNA-associated Sm-like protein LSm3

 
Known abbreviations: LSM3, MDS017

 

FUNCTION:
 
Binds specifically to the 3'-terminal U-tract of U6 snRNA.
 
SUBUNIT STRUCTURE:
 
LSm subunits form a heteromer with a doughnut shape. Identified in the spliceosome C complex.
 
CELLULAR LOCALIZATION:
 
Nucleus (Potential.)



This protein can be a part of a given complexes: Activities in which U6 snRNA-associated Sm-like protein LSm3 is involved: Pathways in which U6 snRNA-associated Sm-like protein LSm3 is involved:

NCBI GI number(s): 7657315
258613882
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot P62310 P62310
BRENDA - -
KEGG hsa:27258 hsa:27258
PFAM: PF01423
PF01423
InterPro: IPR010920
IPR001163
IPR006649
IPR010920
IPR001163
IPR006649
CATH: - -
SCOP: - -


Protein sequence:
MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHL
NMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLR
VG

U6 snRNA-associated Sm-like protein LSm3 (Homo sapiens) is product of expression of LSM3 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis. Jurica MS, Licklider LJ, Gygi SR, Grigorieff N, Moore MJ RNA 2002-04-01 (8) 11991638
Sm and Sm-like proteins assemble in two related complexes of deep evolutionary origin. Salgado-Garrido J, Bragado-Nilsson E, Kandels-Lewis S, Seraphin B EMBO J 1999-06-15 (18) 10369684
A doughnut-shaped heteromer of human Sm-like proteins binds to the 3'-end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro. Achsel T, Brahms H, Kastner B, Bachi A, Wilm M, Luhrmann R EMBO J 1999-10-15 (18) 10523320
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem 2009-06-01 (81) 19413330
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.