Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Protein CAF40

 
Known also as: 40 kDa CCR4-associated factor

Known abbreviations: CAF40

FUNCTION:

Acts as component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover.

SUBUNIT:

Subunit of the 1.0 MDa CCR4-NOT core complex that contains CCR4, CAF1, NOT1, NOT2, NOT3, NOT4, NOT5, CAF40 and CAF130. In the complex interacts with NOT1. The core complex probably is part of a less characterized 1.9 MDa CCR4-NOT complex.

CELLULAR LOCALIZATION:

 Cytoplasm (Probable). Nucleus (Probable).
 




This protein can be a part of a given complexes: Activities in which Protein CAF40 is involved: Pathways in which Protein CAF40 is involved:

NCBI GI number(s): 1730650
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P53829 P53829
BRENDA - -
KEGG sce:YNL288W sce:YNL288W
PFAM: PF04078
PF04078
InterPro: IPR011989
IPR016024
IPR007216
IPR011989
IPR016024
IPR007216
CATH: - -
SCOP: - -


Protein sequence:
MFSAQKPIYGNGAGVNMGGGGPSTNNPGSMSMPGVPTSMGPGMNQQIPSG
GPMLMGNTPNNNNSNENGENNGNNGNNGGNDANATRNNPNMVNNRGAVHA
LDDPNVYHWICQLTYGPQKEQALLELGRKREQFDDLAVVLWSSFGVMTSL
LNEIISVYPMLQPQMLSNNLSNRVCNALVLLQCVASHPETKHLFLQAHIP
LFLFPFLNTTSRQRTFEYLRLTSLGVIGALVKNDSQDVITFLLRTDIVPL
CLRIMESSSELSKTVAIFILQKILLDDVGLQYICATLERFYAVTNVLKDM
VEHLTVSTPPGRLLKHIIRCYLRLSDDLEARRLLKIVLPAKLRDNTFTEV
LRDDVGSKRCLAQLLLTLNEETS

Protein CAF40 (Saccharomyces cerevisiae) is product of expression of CAF40 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications. Philippsen P, Kleine K, Pohlmann R, Dusterhoft A, Hamberg K, Hegemann JH, Obermaier B, Urrestarazu LA, Aert R, Albermann K Nature 1997-05-01 (387) 9169873
Purification and characterization of the 1.0 MDa CCR4-NOT complex identifies two novel components of the complex. Chen J, Rappsilber J, Chiang YC, Russell P, Mann M, Denis CL J Mol Biol 2001-12-07 (314) 11733989
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106



Add your own comment!


There are no comments yet.

Entry added on: 2010-04-12 22:49:22, by a user: kaja

Welcome stranger! Click here to login or here to register.