Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

U6 snRNA-associated Sm-like protein LSm4

 
Known also as: Glycine-rich protein

Known abbreviations: LSM4

 

FUNCTION:
 
Binds specifically to the 3'-terminal U-tract of U6 snRNA.



This protein can be a part of a given complexes: Activities in which U6 snRNA-associated Sm-like protein LSm4 is involved: Pathways in which U6 snRNA-associated Sm-like protein LSm4 is involved:

NCBI GI number(s): 6912486
355477273
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9Y4Z0 Q9Y4Z0
BRENDA - -
KEGG hsa:25804 hsa:25804
PFAM: PF01423
PF01423
InterPro: IPR010920
IPR001163
IPR006649
IPR010920
IPR001163
IPR006649
CATH: - -
SCOP: - -


Protein sequence:
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDG
DKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQK
GRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

U6 snRNA-associated Sm-like protein LSm4 (Homo sapiens) is product of expression of LSM4 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Sm and Sm-like proteins assemble in two related complexes of deep evolutionary origin. Salgado-Garrido J, Bragado-Nilsson E, Kandels-Lewis S, Seraphin B EMBO J 1999-06-15 (18) 10369684
A doughnut-shaped heteromer of human Sm-like proteins binds to the 3'-end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro. Achsel T, Brahms H, Kastner B, Bachi A, Wilm M, Luhrmann R EMBO J 1999-10-15 (18) 10523320
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL Proc Natl Acad Sci U S A 2000-08-15 (97) 10931946



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.