Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

U6 snRNA-associated Sm-like protein LSm5

 
Known abbreviations: LSM5

 

FUNCTION:
 
Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.



This protein can be a part of a given complexes: Activities in which U6 snRNA-associated Sm-like protein LSm5 is involved: Pathways in which U6 snRNA-associated Sm-like protein LSm5 is involved:

NCBI GI number(s): 195222721
195222722
213385305
213385304
6912488
195539322
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9Y4Y9 Q9Y4Y9
BRENDA - -
KEGG hsa:23658 hsa:23658
PFAM: - Q9Y4Y9 (Link - using uniprot id)
InterPro: IPR010920
IPR001163
IPR006649
IPR010920
IPR001163
IPR006649
CATH: - -
SCOP: - -


Protein sequence:
MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMV
LEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

U6 snRNA-associated Sm-like protein LSm5 (Homo sapiens) is product of expression of LSM5 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Sm and Sm-like proteins assemble in two related complexes of deep evolutionary origin. Salgado-Garrido J, Bragado-Nilsson E, Kandels-Lewis S, Seraphin B EMBO J 1999-06-15 (18) 10369684
A doughnut-shaped heteromer of human Sm-like proteins binds to the 3'-end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro. Achsel T, Brahms H, Kastner B, Bachi A, Wilm M, Luhrmann R EMBO J 1999-10-15 (18) 10523320
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem 2009-06-01 (81) 19413330
The DNA sequence of human chromosome 7. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R Nature 2003-07-10 (424) 12853948



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.