Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

U6 snRNA-associated Sm-like protein LSm7

 
Known abbreviations: LSM7

 

FUNCTION:
 
Binds specifically to the 3'-terminal U-tract of U6 snRNA. 



This protein can be a part of a given complexes: Activities in which U6 snRNA-associated Sm-like protein LSm7 is involved: Pathways in which U6 snRNA-associated Sm-like protein LSm7 is involved:

NCBI GI number(s): 7706423
187936927
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9UK45 Q9UK45
BRENDA - -
KEGG hsa:51690 hsa:51690
PFAM: PF01423
PF01423
InterPro: IPR010920
IPR001163
IPR006649
IPR017132
IPR010920
IPR001163
IPR006649
IPR017132
CATH: - -
SCOP: - -


Protein sequence:
MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDG
TIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQ
QDA

U6 snRNA-associated Sm-like protein LSm7 (Homo sapiens) is product of expression of LSM7 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
A doughnut-shaped heteromer of human Sm-like proteins binds to the 3'-end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro. Achsel T, Brahms H, Kastner B, Bachi A, Wilm M, Luhrmann R EMBO J 1999-10-15 (18) 10523320
Carcinogenesis and translational controls: TACC1 is down-regulated in human cancers and associates with mRNA regulators. Conte N, Charafe-Jauffret E, Delaval B, Adelaide J, Ginestier C, Geneix J, Isnardon D, Jacquemier J, Birnbaum D Oncogene 2002-08-15 (21) 12165861
The DNA sequence and biology of human chromosome 19. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M Nature 2004-04-01 (428) 15057824
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.