Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

mRNA-decapping enzyme 1B

 
Known abbreviations: DCP1B

 

FUNCTION:
 
May play a role in the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. May remove the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP (By similarity.)
 
SUBUNIT STRUCTURE:
 
Binds DCP1A. Part of a complex containing enzymes involved in mRNA decay, including DCP2, LSM1, LSM3 and CNOT6.
 
CELLULAR LOCALIZATION:
Cytoplasm. Nucleus (By similarity)



This protein can be a part of a given complexes: Activities in which mRNA-decapping enzyme 1B is involved: Pathways in which mRNA-decapping enzyme 1B is involved:

NCBI GI number(s): 40548403
40548402
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q8IZD4 Q8IZD4
BRENDA - -
KEGG hsa:196513 hsa:196513
PFAM: PF06058
PF06058
InterPro: IPR010334
IPR010334
CATH: - -
SCOP: - -


Protein sequence:
MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEW
EKTDVEGTLFVYTRSASPKHGFTIMNRLSMENRTEPITKDLDFQLQDPFL
LYRNARLSIYGIWFYDKEECQRIAELMKNLTQYEQLKAHQGTGAGISPVI
LNSGEGKEVDILRMLIKAKDEYTKCKTCSEPKKITSSSAIYDNPNLIKPI
PVKPSENQQQRIPQPNQTLDPEPQHLSLTALFGKQDKATCQETVEPPQTL
HQQQQQQQQQQEKLPIRQGVVRSLSYEEPRRHSPPIEKQLCPAIQKLMVR
SADLHPLSELPENRPCENGSTHSAGEFFTGPVQPGSPHNIGTSRGVQNAS
RTQNLFEKLQSTPGAANKCDPSTPAPASSAALNRSRAPTSVTPVAPGKGL
AQPPQAYFNGSLPPQTVGHQAHGREQSTLPRQTLPISGSQTGSSGVISPQ
ELLKKLQIVQQEQQLHASNRPALAAKFPVLAQSSGTGKPLESWINKTPNT
EQQTPLFQVISPQRIPATAAPSLLMSPMVFAQPTSVPPKERESGLLPVGG
QEPPAAATSLLLPIQSPEPSVITSSPLTKLQLQEALLYLIQNDDNFLNII
YEAYLFSMTQAAMKKTM

MRNA-decapping enzyme 1B (Homo sapiens) is product of expression of DCP1B gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Identification of a human decapping complex associated with hUpf proteins in nonsense-mediated decay. Lykke-Andersen J Mol Cell Biol 2002-12-01 (22) 12417715
A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP Nat Biotechnol 2006-10-01 (24) 16964243
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem 2009-06-01 (81) 19413330
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK Sci Signal 2009-01-01 (2) 19690332
Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ Nat Biotechnol 2005-02-01 (23) 15592455
Cytoplasmic foci are sites of mRNA decay in human cells. Cougot N, Babajko S, Seraphin B J Cell Biol 2004-04-01 (165) 15067023
The finished DNA sequence of human chromosome 12. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA Nature 2006-03-16 (440) 16541075
Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ Cell 2007-12-14 (131) 18083107



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.