|
Known abbreviations: DCP1B
FUNCTION:
May play a role in the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. May remove the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP (By similarity.)
SUBUNIT STRUCTURE:
Binds DCP1A. Part of a complex containing enzymes involved in mRNA decay, including DCP2, LSM1, LSM3 and CNOT6.
CELLULAR LOCALIZATION:
Cytoplasm. Nucleus (By similarity)
|
This protein can be a part of a given complexes:
Activities in which mRNA-decapping enzyme 1B is involved:
Pathways in which mRNA-decapping enzyme 1B is involved:
Links to other databases:
Protein sequence:
MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEW
EKTDVEGTLFVYTRSASPKHGFTIMNRLSMENRTEPITKDLDFQLQDPFL
LYRNARLSIYGIWFYDKEECQRIAELMKNLTQYEQLKAHQGTGAGISPVI
LNSGEGKEVDILRMLIKAKDEYTKCKTCSEPKKITSSSAIYDNPNLIKPI
PVKPSENQQQRIPQPNQTLDPEPQHLSLTALFGKQDKATCQETVEPPQTL
HQQQQQQQQQQEKLPIRQGVVRSLSYEEPRRHSPPIEKQLCPAIQKLMVR
SADLHPLSELPENRPCENGSTHSAGEFFTGPVQPGSPHNIGTSRGVQNAS
RTQNLFEKLQSTPGAANKCDPSTPAPASSAALNRSRAPTSVTPVAPGKGL
AQPPQAYFNGSLPPQTVGHQAHGREQSTLPRQTLPISGSQTGSSGVISPQ
ELLKKLQIVQQEQQLHASNRPALAAKFPVLAQSSGTGKPLESWINKTPNT
EQQTPLFQVISPQRIPATAAPSLLMSPMVFAQPTSVPPKERESGLLPVGG
QEPPAAATSLLLPIQSPEPSVITSSPLTKLQLQEALLYLIQNDDNFLNII
YEAYLFSMTQAAMKKTM
|
MRNA-decapping enzyme 1B (Homo sapiens) is product of expression of
DCP1B
gene.
References:
Title |
Authors |
Journal
| Publication date (Issue)
| PubMed ID
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K |
Genome Res
|
2004-10-01 (14) |
15489334 |
Complete sequencing and characterization of 21,243 full-length human cDNAs. |
Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K |
Nat Genet
|
2004-02-01 (36) |
14702039 |
Identification of a human decapping complex associated with hUpf proteins in nonsense-mediated decay. |
Lykke-Andersen J |
Mol Cell Biol
|
2002-12-01 (22) |
12417715 |
A probability-based approach for high-throughput protein phosphorylation analysis and site localization. |
Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP |
Nat Biotechnol
|
2006-10-01 (24) |
16964243 |
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. |
Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S |
Anal Chem
|
2009-06-01 (81) |
19413330 |
Initial characterization of the human central proteome. |
Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J |
BMC Syst Biol
|
2011-01-01 (5) |
21269460 |
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. |
Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK |
Sci Signal
|
2009-01-01 (2) |
19690332 |
Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. |
Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ |
Nat Biotechnol
|
2005-02-01 (23) |
15592455 |
Cytoplasmic foci are sites of mRNA decay in human cells. |
Cougot N, Babajko S, Seraphin B |
J Cell Biol
|
2004-04-01 (165) |
15067023 |
The finished DNA sequence of human chromosome 12. |
Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA |
Nature
|
2006-03-16 (440) |
16541075 |
Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. |
Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ |
Cell
|
2007-12-14 (131) |
18083107 |
Add your own comment!
There are no comments yet.
Last modification of this entry: Sept. 25, 2012.
|