Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Protein CAF130

 
Known also as: 130 kDa CCR4-associated factor

Known abbreviations: CAF130

FUNCTION:

Acts as component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover.

SUBUNIT:

Subunit of the 1.0 MDa CCR4-NOT core complex that contains CCR4, CAF1, NOT1, NOT2, NOT3, NOT4, NOT5, CAF40 and CAF130. In the complex interacts with NOT1. The core complex probably is part of a less characterized 1.9 MDa CCR4-NOT complex.

CELLULAR LOCALIZATION: 

Cytoplasm (Probable). Nucleus (Probable).




This protein can be a part of a given complexes: Activities in which Protein CAF130 is involved: Pathways in which Protein CAF130 is involved:

NCBI GI number(s): 1723712
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P53280 P53280
BRENDA - -
KEGG sce:YGR134W sce:YGR134W
PFAM: - P53280 (Link - using uniprot id)
InterPro: - P53280 (Link - using uniprot id)
CATH: - -
SCOP: - -


Protein sequence:
MTKKKAATNYAERQNLASEDSSGDSVHFKDFIPLQELLKDKNYVPSVENL
EKILYNETMFNDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLKERK
SWAQSFENNSSSYASIVLSWKDNDILLLKFLRFLLANKTAPLQINRYNLP
EYKLPLSFLIVSKITIPSILLNETYNLLKDYLYSITGRIESLISCSSTFD
KPALVVRKILKDYNRMIECRNFYFWYSFNAENRVNLTFSDNISLLMENDE
GNAGSGLDDSRFDHQKQPREAIMGRTINDQEQIYSFELNQDGTLEIPNVM
EHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIIS
IDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCF
DFDILNSVNNTDNAVHWKTQLHRWLPHGLNTQDLELLYMIDILAVYTIYK
LYEKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVR
ATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALY
ADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDE
SFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGAN
EAFGSTNSENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEF
DYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEES
ILLVRSVASCVRNEQDQMILADLESNFSASINGDVEGEGNTKMSKIDNED
LRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWF
LTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQKN
EDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNNEEENEDGEK
ISLYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEA
KDLFFKIKTRLAMEEEDSADTMQHEGRKNSDIEKKLNAKPASELNLKLLN
LFPSKPANKDDSSPINTLRSFIADYSFDTQVNPPGRRVVFYDGKILPLPK
ADKPIPLHEYITLAELDVGDSE

Protein CAF130 (Saccharomyces cerevisiae) is product of expression of CAF130 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K Nature 1997-05-01 (387) 9169869
Purification and characterization of the 1.0 MDa CCR4-NOT complex identifies two novel components of the complex. Chen J, Rappsilber J, Chiang YC, Russell P, Mann M, Denis CL J Mol Biol 2001-12-07 (314) 11733989
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956



Add your own comment!


There are no comments yet.

Entry added on: 2010-04-12 22:51:18, by a user: kaja

Welcome stranger! Click here to login or here to register.