Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Enhancer of mRNA-decapping protein 4

 
Known also as: Autoantigen Ge-1, Autoantigen RCD-8, Human enhancer of decapping large subunit

Known abbreviations: EDC4, HEDLS

 

FUNCTION:
 
In the process of mRNA degradation, seems to play a role in mRNA decapping. Component of a complex containing DCP2 and DCP1A which functions in decapping of ARE-containing mRNAs. Promotes complex formation between DCP1A and DCP2. Enhances the catalytic activity of DCP2 (in vitro). 
 
SUBUNIT STRUCTURE:
 
Part of a decapping complex consisting of DCP1A, DCP2, EDC3, EDC4 and probably DDX6. Part of a complex consisting of DCP1A, EDC3, EDC4 and DDX6. Part of a complex consisting of DCP1B, EDC3, EDC4 and DDX6. Interacts with DCP2. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm › P-body. Nucleus .
 
POST-TRANSLATIONAL MODIFICATION:
 
Phosphorylated upon DNA damage, probably by ATM or ATR.



This protein can be a part of a given complexes: Activities in which Enhancer of mRNA-decapping protein 4 is involved: Pathways in which Enhancer of mRNA-decapping protein 4 is involved:

NCBI GI number(s): 45827771
356461041
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q6P2E9 Q6P2E9
BRENDA - -
KEGG hsa:23644 hsa:23644
PFAM: - Q6P2E9 (Link - using uniprot id)
InterPro: IPR015943
IPR001680
IPR017986
IPR015943
IPR001680
IPR017986
CATH: - -
SCOP: - -


Protein sequence:
MASCASIDIEDATQHLRDILKLDRPAGGPSAESPRPSSAYNGDLNGLLVP
DPLCSGDSTSANKTGLRTMPPINLQEKQVICLSGDDSSTCIGILAKEVEI
VASSDSSISSKARGSNKVKIQPVAKYDWEQKYYYGNLIAVSNSFLAYAIR
AANNGSAMVRVISVSTSERTLLKGFTGSVADLAFAHLNSPQLACLDEAGN
LFVWRLALVNGKIQEEILVHIRQPEGTPLNHFRRIIWCPFIPEESEDCCE
ESSPTVALLHEDRAEVWDLDMLRSSHSTWPVDVSQIKQGFIVVKGHSTCL
SEGALSPDGTVLATASHDGYVKFWQIYIEGQDEPRCLHEWKPHDGRPLSC
LLFCDNHKKQDPDVPFWRFLITGADQNRELKMWCTVSWTCLQTIRFSPDI
FSSVSVPPSLKVCLDLSAEYLILSDVQRKVLYVMELLQNQEEGHACFSSI
SEFLLTHPVLSFGIQVVSRCRLRHTEVLPAEEENDSLGADGTHGAGAMES
AAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAPLPTHTAHEDFTFGESR
PELGSEGLGSAAHGSQPDLRRIVELPAPADFLSLSSETKPKLMTPDAFMT
PSASLQQITASPSSSSSGSSSSSSSSSSSLTAVSAMSSTSAVDPSLTRPP
EELTLSPKLQLDGSLTMSSSGSLQASPRGLLPGLLPAPADKLTPKGPGQV
PTATSALSLELQEVEPLGLPQASPSRTRSPDVISSASTALSQDIPEIASE
ALSRGFGSSAPEGLEPDSMASAASALHLLSPRPRPGPELGPQLGLDGGPG
DGDRHNTPSLLEAALTQEASTPDSQVWPTAPDITRETCSTLAESPRNGLQ
EKHKSLAFHRPPYHLLQQRDSQDASAEQSDHDDEVASLASASGGFGTKVP
APRLPAKDWKTKGSPRTSPKLKRKSKKDDGDAAMGSRLTEHQVAEPPEDW
PALIWQQQRELAELRHSQEELLQRLCTQLEGLQSTVTGHVERALETRHEQ
EQRRLERALAEGQQRGGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKT
VPPCVSRSLEPMAGQLSNSVATKLTAVEGSMKENISKLLKSKNLTDAIAR
AAADTLQGPMQAAYREAFQSVVLPAFEKSCQAMFQQINDSFRLGTQEYLQ
QLESHMKSRKAREQEAREPVLAQLRGLVSTLQSATEQMAATVAGSVRAEV
QHQLHVAVGSLQESILAQVQRIVKGEVSVALKEQQAAVTSSIMQAMRSAA
GTPVPSAHLDCQAQQAHILQLLQQGHLNQAFQQALTAADLNLVLYVCETV
DPAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHS
DPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAARRLSLMLHGLVTPSL
P

Enhancer of mRNA-decapping protein 4 (Homo sapiens) is product of expression of EDC4 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Multiple processing body factors and the ARE binding protein TTP activate mRNA decapping. Fenger-Gron M, Fillman C, Norrild B, Lykke-Andersen J Mol Cell 2005-12-22 (20) 16364915
Cytoplasmic detection of a novel protein containing a nuclear localization sequence by human autoantibodies. Garcia-Lozano JR, Gonzalez-Escribano MF, Wichmann I, Nunez-Roldan A Clin Exp Immunol 1997-03-01 (107) 9067524
The immunoreactive region in a novel autoantigen contains a nuclear localization sequence. Bloch DB, Rabkina D, Quertermous T, Bloch KD Clin Immunol Immunopathol 1994-09-01 (72) 7520377
A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP Nat Biotechnol 2006-10-01 (24) 16964243
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M Cell 2006-11-03 (127) 17081983
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem 2009-06-01 (81) 19413330
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ Science 2007-05-25 (316) 17525332
Lysine acetylation targets protein complexes and co-regulates major cellular functions. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M Science 2009-08-14 (325) 19608861
A quantitative atlas of mitotic phosphorylation. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP Proc Natl Acad Sci U S A 2008-08-05 (105) 18669648
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK Sci Signal 2009-01-01 (2) 19690332
Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M Mol Cell 2008-08-08 (31) 18691976
Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd J Proteome Res 2008-03-01 (7) 18220336
The sequence and analysis of duplication-rich human chromosome 16. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M Nature 2004-12-23 (432) 15616553
Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD J Proteome Res 2007-11-01 (6) 17924679
Large-scale proteomics analysis of the human kinome. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H Mol Cell Proteomics 2009-07-01 (8) 19369195
Phosphoproteome analysis of the human mitotic spindle. Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R Proc Natl Acad Sci U S A 2006-04-04 (103) 16565220



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.