Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

5'-3' exoribonuclease 1

 
Known also as: Strand-exchange protein 1 homolog

Known abbreviations: XRN1, SEP1

FUNCTION:

 
Major 5'-3' exoribonuclease involved in mRNA decay. Required for the 5'-3'-processing of the G4 tetraplex-containing DNA and RNA substrates. The kinetic of hydrolysis is faster for G4 RNA tetraplex than for G4 DNA tetraplex and monomeric RNA tetraplex. Binds to RNA and DNA By similarity. Plays a role in replication-dependent histone mRNA degradation. May act as a tumor suppressor protein in osteogenic sarcoma (OGS). 
 
SUBUNIT STRUCTURE:
 
Associates with alpha and beta tubulins By similarity. Found in a mRNP complex with UPF1, UPF2, UPF3B and XRN1.
 
CELLULAR LOCALIZATION:
 
Cytoplasm. Note: Discrete foci at the inner surface of the cell membrane. 
 
TISSUE SPECIFICITY:
 
Expressed in heart, brain, pancreas, spleen, testis, osteogenic sarcoma (OGS) biopsy and primary cell lines. 
 
INDUCTION:
 
By GDNF/glial cell line-derived neurotrophic factor. 



Activities in which 5'-3' exoribonuclease 1 is involved: Pathways in which 5'-3' exoribonuclease 1 is involved:

NCBI GI number(s): 110624787
110624786
110624792
110624791
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q8IZH2 Q8IZH2
BRENDA - -
KEGG hsa:54464 hsa:54464
PFAM: PF03159
PF03159
InterPro: IPR016494
IPR004859
IPR016494
IPR004859
CATH: - -
SCOP: - -


Protein sequence:
MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDD
VHFRISDDKIFTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGR
RFRSAKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFMARLHEHLKYF
VNMKISTDKSWQGVTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRH
CLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCAPEETTFHLLH
LSLMREYIDYEFSVLKEKITFKYDIERIIDDWILMGFLVGNDFIPHLPHL
HINHDALPLLYGTYVTILPELGGYINESGHLNLPRFEKYLVKLSDFDREH
FSEVFVDLKWFESKVGNKYLNEAAGVAAEEARNYKEKKKLKGQENSLCWT
ALDKNEGEMITSKDNLEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDD
FLADQAACYVQAIQWILHYYYHGVQSWSWYYPYHYAPFLSDIHNISTLKI
HFELGKPFKPFEQLLAVLPAASKNLLPACYQHLMTNEDSPIIEYYPPDFK
TDLNGKQQEWEAVVLIPFIDEKRLLEAMETCNHSLKKEERKRNQHSECLM
CWYDRDTEFIYPSPWPEKFPAIERCCTRYKIISLDAWRVDINKNKITRID
QKALYFCGFPTLKHIRHKFFLKKSGVQVFQQSSRGENMMLEILVDAESDE
LTVENVASSVLGKSVFVNWPHLEEARVVAVSDGETKFYLEEPPGTQKLYS
GRTAPPSKVVHLGDKEQSNWAKEVQGISEHYLRRKGIIINETSAVVYAQL
LTGRKYQINQNGEVRLEKQWSKQVVPFVYQTIVKDIRAFDSRFSNIKTLD
DLFPLRSMVFMLGTPYYGCTGEVQDSGDVITEGRIRVIFSIPCEPNLDAL
IQNQHKYSIKYNPGYVLASRLGVSGYLVSRFTGSIFIGRGSRRNPHGDHK
ANVGLNLKFNKKNEEVPGYTKKVGSEWMYSSAAEQLLAEYLERAPELFSY
IAKNSQEDVFYEDDIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCDLQ
ILDAAIVEKIEEEVEKCKQRKNNKKVRVTVKPHLLYRPLEQQHGVIPDRD
AEFCLFDRVVNVRENFSVPVGLRGTIIGIKGANREADVLFEVLFDEEFPG
GLTIRCSPGRGYRLPTSALVNLSHGSRSETGNQKLTAIVKPQPAVHQHSS
SSSVSSGHLGALNHSPQSLFVPTQVPTKDDDEFCNIWQSLQGSGKMQYFQ
PTIQEKGAVLPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSP
KAECWSQKMSNKQPNSGIENFLASLNISKENEVQSSHHGEPPSEEHLSPQ
SFAMGTRMLKEILKIDGSNTVDHKNEIKQIANEIPVSSNRRDEYGLPSQP
KQNKKLASYMNKPHSANEYHNVQSMDNMCWPAPSQIPPVSTPVTELSRIC
SLVGMPQPDFSFLRMPQTMTVCQVKLSNGLLVHGPQCHSENEAKEKAALF
ALQQLGSLGMNFPLPSQVFANYPSAVPPGTIPPAFPPPTGWDHYGSNYAL
GAANIMPSSSHLFGSMPWGPSVPVPGKPFHHTLYSGTMPMAGGIPGGVHN
QFIPLQVTKKRVANKKNFENKEAQSSQATPVQTSQPDSSNIVKVSPRESS
SASLKSSPIAQPASSFQVETASQGHSISHHKSTPISSSRRKSRKLAVNFG
VSKPSE

5'-3' exoribonuclease 1 (Homo sapiens) is product of expression of XRN1 gene.

5'-3' exoribonuclease 1 (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Degradation of histone mRNA requires oligouridylation followed by decapping and simultaneous degradation of the mRNA both 5' to 3' and 3' to 5'. Mullen TE, Marzluff WF Genes Dev 2008-02-01 (22) 18172165
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M Cell 2006-11-03 (127) 17081983
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
The full-ORF clone resource of the German cDNA Consortium. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I BMC Genomics 2007-01-01 (8) 17974005
Identification of human SEP1 as a glial cell line-derived neurotrophic factor-inducible protein and its expression in the nervous system. Shimoyama Y, Morikawa Y, Ichihara M, Kodama Y, Fukuda N, Hayashi H, Morinaga T, Iwashita T, Murakumo Y, Takahashi M Neuroscience 2003-01-01 (121) 14580940
Cloning and characterization of human Sep1 (hSEP1) gene and cytoplasmic localization of its product. Sato Y, Shimamoto A, Shobuike T, Sugimoto M, Ikeda H, Kuroda S, Furuichi Y DNA Res 1998-08-31 (5) 9802570
Nonsense-mediated mRNA decay in mammalian cells involves decapping, deadenylating, and exonucleolytic activities. Lejeune F, Li X, Maquat LE Mol Cell 2003-09-01 (12) 14527413
The human LSm1-7 proteins colocalize with the mRNA-degrading enzymes Dcp1/2 and Xrnl in distinct cytoplasmic foci. Ingelfinger D, Arndt-Jovin DJ, Luhrmann R, Achsel T RNA 2002-12-01 (8) 12515382
The human homolog of yeast SEP1 is a novel candidate tumor suppressor gene in osteogenic sarcoma. Zhang K, Dion N, Fuchs B, Damron T, Gitelis S, Irwin R, O'Connor M, Schwartz H, Scully SP, Rock MG, Bolander ME, Sarkar G Gene 2002-10-02 (298) 12426100



Add your own comment!


There are no comments yet.

Last modification of this entry: 2013-02-01 14:07:31
Edited by a user: kaja
Edited content: Changed protein_family.

Welcome stranger! Click here to login or here to register.