Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Enhancer of mRNA-decapping protein 3

 
Known abbreviations: EDC3, LSM16, YEL015W

 

FUNCTION:
 
Stimulates decapping of both stable and unstable mRNA during mRNA decay. Does not affect nonsense-mediated mRNA decay. Required for normal P-body assembly. 
 
SUBUNIT STRUCTURE:
 
Homodimer. Interacts with DCP2. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm › P-body. Note: Is concentrated in several cytoplasmic foci called P bodies (or cytoplasmic processing bodies) which represent sites of mRNA decapping and 5' to 3' exonucleotidic decay. 



Activities in which Enhancer of mRNA-decapping protein 3 is involved: Pathways in which Enhancer of mRNA-decapping protein 3 is involved:

NCBI GI number(s): 296143942
6320822
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P39998 P39998
BRENDA - -
KEGG sce:YEL015W sce:YEL015W
PFAM: PF09532
PF03853
PF09532
PF03853
InterPro: IPR019050
IPR004443
IPR019050
IPR004443
CATH: - -
SCOP: - -


Protein sequence:
MSQFVGFGVQVELKDGKLIQGKIAKATSKGLTLNDVQFGDGGKSQAFKVR
ASRLKDLKVLTVASQSGKRKQQRQQQQQNDYNQNRGEHIDWQDDDVSKIK
QQEDFDFQRNLGMFNKKDVFAQLKQNDDILPENRLQGHNRKQTQLQQNNY
QNDELVIPDAKKDSWNKISSRNEQSTHQSQPQQDAQDDLVLEDDEHEYDV
DDIDDPKYLPITQSLNITHLIHSATNSPSINDKTKGTVINDKDQVLAKLG
QMIISQSRSNSTSLPAANKQTTIRSKNTKQNIPMATPVQLLEMESITSEF
FSINSAGLLENFAVNASFFLKQKLGGRARLRLQNSNPEPLVVILASDSNR
SGAKALALGRHLCQTGHIRVITLFTCSQNELQDSMVKKQTDIYKKCGGKI
VNSVSSLESAMETLNSPVEIVIDAMQGYDCTLSDLAGTSEVIESRIKSMI
SWCNKQRGSTKVWSLDIPNGFDAGSGMPDIFFSDRIEATGIICSGWPLIA
INNLIANLPSLEDAVLIDIGIPQGAYSQRTSLRKFQNCDLFVTDGSLLLD
L

Enhancer of mRNA-decapping protein 3 (Saccharomyces cerevisiae) is product of expression of EDC3 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome V. Dietrich FS, Mulligan J, Hennessy K, Yelton MA, Allen E, Araujo R, Aviles E, Berno A, Brennan T, Carpenter J, Chen E, Cherry JM, Chung E, Duncan M, Guzman E, Hartzell G, Hunicke-Smith S, Hyman RW, Kayser A, Komp C, Lashkari D, Lew H, Lin D, Mosedale D, Davis RW, et al. Nature 1997-05-01 (387) 9169868
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res 2007-03-01 (6) 17330950
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Identification of Edc3p as an enhancer of mRNA decapping in Saccharomyces cerevisiae. Kshirsagar M, Parker R Genetics 2004-01-01 (166) 15020463
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF Proc Natl Acad Sci U S A 2007-01-13 (104) 17287358



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.