Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

40S ribosomal protein S28-B

 
Known abbreviations: S33, YS27, RPS28B, RPS33B, YLR264W, L8479.5

 

SUBUNIT STRUCTURE:
 
Component of the small ribosomal subunit. Mature ribosomes consist of a small (40S) and a large (60S) subunit. The 40S subunit contains 32 different proteins (encoded by 56 genes) and 1 molecule of RNA (18S). The 60S subunit contains 46 different proteins (encoded by 81 genes) and 3 molecules of RNA (25S, 5.8S and 5S).
 
CELLULAR LOCALIZATION:
 
Cytoplasm.
 
POST-TRANSLATIONAL MODIFICATION:
 
N-terminally acetylated by acetyltransferase NatB.



Activities in which 40S ribosomal protein S28-B is involved: Pathways in which 40S ribosomal protein S28-B is involved:

NCBI GI number(s): 6323294
296146797
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P0C0X0 P0C0X0
BRENDA - -
KEGG sce:YLR264W sce:YLR264W
PFAM: PF01200
PF01200
InterPro: IPR012340
IPR016027
IPR000289
IPR012340
IPR016027
IPR000289
CATH: - -
SCOP: - -


Protein sequence:
MDSKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRE
NDILVLMESEREARRLR

40S ribosomal protein S28-B (Saccharomyces cerevisiae) is product of expression of RPS28B gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The nucleotide sequence of Saccharomyces cerevisiae chromosome XII. Johnston M, Hillier L, Riles L, Albermann K, Andre B, Ansorge W, Benes V, Bruckner M, Delius H, Dubois E, Dusterhoft A, Entian KD, Floeth M, Goffeau A, Hebling U, Heumann K, Heuss-Neitzel D, Hilbert H, Hilger F, Kleine K, Kotter P, Louis EJ, Messenguy F, Mewes HW, Hoheisel JD, et al. Nature 1997-05-01 (387) 9169871
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356
The list of cytoplasmic ribosomal proteins of Saccharomyces cerevisiae. Planta RJ, Mager WH Yeast 1998-03-01 (14) 9559554
The action of N-terminal acetyltransferases on yeast ribosomal proteins. Arnold RJ, Polevoda B, Reilly JP, Sherman F J Biol Chem 1999-12-24 (274) 10601260



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.