Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

mRNA-decapping enzyme subunit 1

 
Known abbreviations: DCP1, YOL149W

 

FUNCTION:
 
Component of the decapping complex necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Decapping is the major pathway of mRNA degradation in yeast. It occurs through deadenylation, decapping and subsequent 5' to 3' exonucleolytic decay of the transcript body. DCP1 is activated by the DEAD-box helicase DHH1 and destabilizes the eIF-4F cap-binding complex from the mRNA. 
 
SUBUNIT STRUCTURE:
 
Component of the decapping complex composed of DCP1 and DCP2. Interacts with mRNAs, DHH1, LSM1, LSM2, LSM3, LSM4, LSM5, LSM6, LSM7, and the cap-binding proteins PAB1 and TIF4632/eIF-4G. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm › P-body. Note: Is concentrated in several cytoplasmic foci called P bodies (or cytoplasmic processing bodies) which represent sites of mRNA decapping and 5' to 3' exonucleotidic decay. 
 
POST-TRANSLATIONAL MODIFICATION:
 
Phosphorylated. 



This protein can be a part of a given complexes: Activities in which mRNA-decapping enzyme subunit 1 is involved: Pathways in which mRNA-decapping enzyme subunit 1 is involved:

NCBI GI number(s): 6324423
296147858
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q12517 Q12517
BRENDA - -
KEGG sce:YOL149W sce:YOL149W
PFAM: PF06058
PF06058
InterPro: IPR010334
IPR010334
CATH: - -
SCOP: - -
Solved crystal structures: 1Q67
[PDB] [details]


Protein sequence:
MTGAATAAENSATQLEFYRKALNFNVIGRYDPKIKQLLFHTPHASLYKWD
FKKDEWNKLEYQGVLAIYLRDVSQNTNLLPVSPQEVDIFDSQNGSNNIQV
NNGSDNSNRNSSGNGNSYKSNDSLTYNCGKTLSGKDIYNYGLIILNRINP
DNFSMGIVPNSVVNKRKVFNAEEDTLNPLECMGVEVKDELVIIKNLKHEV
YGIWIHTVSDRQNIYELIKYLLENEPKDSFA

MRNA-decapping enzyme subunit 1 (Saccharomyces cerevisiae) is product of expression of DCP1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The 3' to 5' degradation of yeast mRNAs is a general mechanism for mRNA turnover that requires the SKI2 DEVH box protein and 3' to 5' exonucleases of the exosome complex. Anderson JS, Parker RP EMBO J 1998-03-02 (17) 9482746
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature 1997-05-01 (387) 9169874
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
The eukaryotic mRNA decapping protein Dcp1 interacts physically and functionally with the eIF4F translation initiation complex. Vilela C, Velasco C, Ptushkina M, McCarthy JE EMBO J 2000-08-15 (19) 10944120
Targeting an mRNA for decapping: displacement of translation factors and association of the Lsm1p-7p complex on deadenylated yeast mRNAs. Tharun S, Parker R Mol Cell 2001-11-01 (8) 11741542
Yeast Sm-like proteins function in mRNA decapping and decay. Tharun S, He W, Mayes AE, Lennertz P, Beggs JD, Parker R Nature 2000-03-01 (404) 10761922
The DEAD box helicase, Dhh1p, functions in mRNA decapping and interacts with both the decapping and deadenylase complexes. Coller JM, Tucker M, Sheth U, Valencia-Sanchez MA, Parker R RNA 2001-12-01 (7) 11780629
The DEAD box protein Dhh1 stimulates the decapping enzyme Dcp1. Fischer N, Weis K EMBO J 2002-06-03 (21) 12032091
Decapping and decay of messenger RNA occur in cytoplasmic processing bodies. Sheth U, Parker R Science 2003-05-02 (300) 12730603
The DCP2 protein is required for mRNA decapping in Saccharomyces cerevisiae and contains a functional MutT motif. Dunckley T, Parker R EMBO J 1999-10-01 (18) 10508173
Genome-wide protein interaction screens reveal functional networks involving Sm-like proteins. Fromont-Racine M, Mayes AE, Brunet-Simon A, Rain JC, Colley A, Dix I, Decourty L, Joly N, Ricard F, Beggs JD, Legrain P Yeast 2000-06-01 (17) 10900456
Two related proteins, Edc1p and Edc2p, stimulate mRNA decapping in Saccharomyces cerevisiae. Dunckley T, Tucker M, Parker R Genetics 2001-02-01 (157) 11139489
Analysis of recombinant yeast decapping enzyme. Steiger M, Carr-Schmid A, Schwartz DC, Kiledjian M, Parker R RNA 2003-01-01 (9) 12554866
Crystal structure of Dcp1p and its functional implications in mRNA decapping. She M, Decker CJ, Sundramurthy K, Liu Y, Chen N, Parker R, Song H Nat Struct Mol Biol 2004-03-01 (11) 14758354
DNA sequence analysis of a 13 kbp fragment of the left arm of yeast chromosome XV containing seven new open reading frames. Casamayor A, Aldea M, Casas C, Herrero E, Gamo FJ, Lafuente MJ, Gancedo C, Arino J Yeast 1995-10-01 (11) 8553699
An essential component of the decapping enzyme required for normal rates of mRNA turnover. Beelman CA, Stevens A, Caponigro G, LaGrandeur TE, Hatfield L, Fortner DM, Parker R Nature 1996-08-15 (382) 8757137
Mutations in trans-acting factors affecting mRNA decapping in Saccharomyces cerevisiae. Hatfield L, Beelman CA, Stevens A, Parker R Mol Cell Biol 1996-10-01 (16) 8816497
Isolation and characterization of Dcp1p, the yeast mRNA decapping enzyme. LaGrandeur TE, Parker R EMBO J 1998-03-02 (17) 9482745
Analysis of mutations in the yeast mRNA decapping enzyme. Tharun S, Parker R Genetics 1999-04-01 (151) 10101156
Monitoring mRNA decapping activity. Zhang S, Williams CJ, Wormington M, Stevens A, Peltz SW Methods 1999-02-01 (17) 10075882
Recognition of yeast mRNAs as "nonsense containing" leads to both inhibition of mRNA translation and mRNA degradation: implications for the control of mRNA decapping. Muhlrad D, Parker R Mol Biol Cell 1999-11-01 (10) 10564284
Mutations in translation initiation factors lead to increased rates of deadenylation and decapping of mRNAs in Saccharomyces cerevisiae. Schwartz DC, Parker R Mol Cell Biol 1999-08-01 (19) 10409716
Modulation of eukaryotic mRNA stability via the cap-binding translation complex eIF4F. Ramirez CV, Vilela C, Berthelot K, McCarthy JE J Mol Biol 2002-05-10 (318) 12054793
Loss of translational control in yeast compromised for the major mRNA decay pathway. Holmes LE, Campbell SG, De Long SK, Sachs AB, Ashe MP Mol Cell Biol 2004-04-01 (24) 15024087



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.