Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

mRNA-decapping enzyme subunit 2

 
Known also as: Protein PSU1

Known abbreviations: DCP2, PSU1, YNL118C, N1917

 

FUNCTION:
 
Catalytic component of the decapping complex necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Decapping is the major pathway of mRNA degradation in yeast. It occurs through deadenylation, decapping and subsequent 5' to 3' exonucleolytic decay of the transcript body. 
 
COFACTOR:
 
Manganese (By similarity.)
 
SUBUNIT STRUCTURE:
 
Component of the decapping complex composed of DCP1 and DCP2. Interacts with mRNA, LSM2, LSM4 and LSM8. Interacts with EDC3. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm › P-body. Note: Is concentrated in several cytoplasmic foci called P bodies (or cytoplasmic processing bodies) which represent sites of mRNA decapping and 5' to 3' exonucleotidic decay. 



This protein can be a part of a given complexes: Activities in which mRNA-decapping enzyme subunit 2 is involved: Pathways in which mRNA-decapping enzyme subunit 2 is involved:

NCBI GI number(s): 6324211
296147650
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P53550 P53550
BRENDA - -
KEGG sce:YNL118C sce:YNL118C
PFAM: PF05026
PF00293
PF05026
PF00293
InterPro: IPR007722
IPR020084
IPR000086
IPR015797
IPR007722
IPR020084
IPR000086
IPR015797
CATH: - -
SCOP: - -
Solved crystal structures: 2JVB
[PDB] [details]


Protein sequence:
MSLPLRHALENVTSVDRILEDLLVRFIINCPNEDLSSVERELFHFEEASW
FYTDFIKLMNPTLPSLKIKSFAQLIIKLCPLVWKWDIRVDEALQQFSKYK
KSIPVRGAAIFNENLSKILLVQGTESDSWSFPRGKISKDENDIDCCIREV
KEEIGFDLTDYIDDNQFIERNIQGKNYKIFLISGVSEVFNFKPQVRNEID
KIEWFDFKKISKTMYKSNIKYYLINSMMRPLSMWLRHQRQIKNEDQLKSY
AEEQLKLLLGITKEEQIDPGRELLNMLHTAVQANSNNNAVSNGQVPSSQE
LQHLKEQSGEHNQQKDQQSSFSSQQQPSIFPSLSEPFANNKNVIPPTMPM
ANVFMSNPQLFATMNGQPFAPFPFMLPLTNNSNSANPIPTPVPPNFNAPP
NPMAFGVPNMHNLSGPAVSQPFSLPPAPLPRDSGYSSSSPGQLLDILNSK
KPDSNVQSSKKPKLKILQRGTDLNSIKQNNNDETAHSNSQALLDLLKKPT
SSQKIHASKPDTSFLPNDSVSGIQDAEYEDFESSSDEEVETARDERNSLN
VDIGVNVMPSEKDSRRSQKEKPRNDASKTNLNASAESNSVEWGPGKSSPS
TQSKQNSSVGMQNKYRQEIHIGDSDAYEVFESSSDEEDGKKLEELEQTQD
NSKLISQDILKENNFQDGEVPHRDMPTESNKSINETVGLSSTTNTVKKVP
KVKILKRGETFASLANDKKAFDSSSNVSSSKDLLQMLRNPISSTVSSNQQ
SPKSQHLSGDEEIMMMLKRNSVSKPQNSEENASTSSINDANASELLGMLK
QKEKDITAPKQPYNVDSYSQKNSAKGLLNILKKNDSTGYPRTEGGPSSEM
STSMKRNDATNNQELDKNSTELLNYLKPKPLNDGYENISNKDSSHELLNI
LHGNKNSSAFNNNVYATDGYSLASDNNENSSNKLLNMLQNRSSAINEPNF
DVRSNGTSGSNELLSILHRK

MRNA-decapping enzyme subunit 2 (Saccharomyces cerevisiae) is product of expression of DCP2 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications. Philippsen P, Kleine K, Pohlmann R, Dusterhoft A, Hamberg K, Hegemann JH, Obermaier B, Urrestarazu LA, Aert R, Albermann K Nature 1997-05-01 (387) 9169873
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Identification of a novel component of the nonsense-mediated mRNA decay pathway by use of an interacting protein screen. He F, Jacobson A Genes Dev 1995-01-15 (9) 7883168
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res 2007-03-01 (6) 17330950
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356
Targeting an mRNA for decapping: displacement of translation factors and association of the Lsm1p-7p complex on deadenylated yeast mRNAs. Tharun S, Parker R Mol Cell 2001-11-01 (8) 11741542
Decapping and decay of messenger RNA occur in cytoplasmic processing bodies. Sheth U, Parker R Science 2003-05-02 (300) 12730603
Sequential elimination of major-effect contributors identifies additional quantitative trait loci conditioning high-temperature growth in yeast. Sinha H, David L, Pascon RC, Clauder-Munster S, Krishnakumar S, Nguyen M, Shi G, Dean J, Davis RW, Oefner PJ, McCusker JH, Steinmetz LM Genetics 2008-11-01 (180) 18780730
The DNA sequence of cosmid 14-13b from chromosome XIV of Saccharomyces cerevisiae reveals an unusually high number of overlapping open reading frames. De Antoni A, D'Angelo M, Dal Pero F, Sartorello F, Pandolfo D, Pallavicini A, Lanfranchi G, Valle G Yeast 1997-03-15 (13) 9090055
The DCP2 protein is required for mRNA decapping in Saccharomyces cerevisiae and contains a functional MutT motif. Dunckley T, Parker R EMBO J 1999-10-01 (18) 10508173
Genome-wide protein interaction screens reveal functional networks involving Sm-like proteins. Fromont-Racine M, Mayes AE, Brunet-Simon A, Rain JC, Colley A, Dix I, Decourty L, Joly N, Ricard F, Beggs JD, Legrain P Yeast 2000-06-01 (17) 10900456
Two related proteins, Edc1p and Edc2p, stimulate mRNA decapping in Saccharomyces cerevisiae. Dunckley T, Tucker M, Parker R Genetics 2001-02-01 (157) 11139489
Analysis of recombinant yeast decapping enzyme. Steiger M, Carr-Schmid A, Schwartz DC, Kiledjian M, Parker R RNA 2003-01-01 (9) 12554866
Crystal structure of Dcp1p and its functional implications in mRNA decapping. She M, Decker CJ, Sundramurthy K, Liu Y, Chen N, Parker R, Song H Nat Struct Mol Biol 2004-03-01 (11) 14758354
Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway. Gruhler A, Olsen JV, Mohammed S, Mortensen P, Faergeman NJ, Mann M, Jensen ON Mol Cell Proteomics 2005-03-01 (4) 15665377
mRNA decapping is promoted by an RNA-binding channel in Dcp2. Deshmukh MV, Jones BN, Quang-Dang DU, Flinders J, Floor SN, Kim C, Jemielity J, Kalek M, Darzynkiewicz E, Gross JD Mol Cell 2008-01-15 (29) 18280238



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.