Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

ATP-dependent RNA helicase DHH1

 
Known also as: DExD/H-box helicase 1

Known abbreviations: DHH1, YDL160C

 

FUNCTION:
 
ATP-dependent RNA helicase involved in mRNA turnover, and more specifically in mRNA decapping by activating the decapping enzyme DCP1. Is involved in G1/S DNA-damage checkpoint recovery, probably through the regulation of the translational status of a subset of mRNAs. May also have a role in translation and mRNA nuclear export. Required for sporulation. 
 
CATALYTIC ACTIVITY:
 
ATP + H2O = ADP + phosphate.
 
SUBUNIT STRUCTURE:
 
Associated with the CCR4-NOT complex and possibly other big complexes. Interacts with CDC39/NOT1 and POP2, components of the CCR4-NOT complex, with the mRNA decapping proteins DCP1, LSM1, PAT1, and with KEM1, the major 5'-3' exonuclease. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm › P-body. Note: Is concentrated in several cytoplasmic foci called P bodies (or cytoplasmic processing bodies) which represent sites of mRNA decapping and 5' to 3' exonucleotidic decay. 
 
DOMAIN:
 
The Q motif is unique to and characteristic of the DEAD box family of RNA helicases and controls ATP binding and hydrolysis.



Activities in which ATP-dependent RNA helicase DHH1 is involved: Pathways in which ATP-dependent RNA helicase DHH1 is involved:

NCBI GI number(s): 6320041
296143208
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P39517 P39517
BRENDA - -
KEGG sce:YDL160C sce:YDL160C
PFAM: PF00270
PF00271
PF00270
PF00271
InterPro: IPR011545
IPR014001
IPR001650
IPR000629
IPR014014
IPR011545
IPR014001
IPR001650
IPR000629
IPR014014
CATH: - -
SCOP: - -
Solved crystal structures: 1S2M
[PDB] [details]


Protein sequence:
MGSINNNFNTNNNSNTDLDRDWKTALNIPKKDTRPQTDDVLNTKGNTFED
FYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAF
VIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTG
GTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKM
LSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLM
EELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLA
KKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQ
AVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQ
ELGTEIAAIPATIDKSLYVAENDETVPVPFPIEQQSYHQQAIPQQQLPSQ
QQFAIPPQQHHPQFMVPPSHQQQQAYPPPQMPSQQGYPPQQEHFMAMPPG
QSQPQY

ATP-dependent RNA helicase DHH1 (Saccharomyces cerevisiae) is product of expression of DHH1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature 1997-05-01 (387) 9169867
An essential role for the Saccharomyces cerevisiae DEAD-box helicase DHH1 in G1/S DNA-damage checkpoint recovery. Bergkessel M, Reese JC Genetics 2004-05-01 (167) 15166134
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
A yeast gene encoding a putative RNA helicase of the "DEAD"-box family. Strahl-Bolsinger S, Tanner W Yeast 1993-04-01 (9) 8511971
Dhh1p, a putative RNA helicase, associates with the general transcription factors Pop2p and Ccr4p from Saccharomyces cerevisiae. Hata H, Mitsui H, Liu H, Bai Y, Denis CL, Shimizu Y, Sakai A Genetics 1998-01-01 (148) 9504907
The DEAD box helicase, Dhh1p, functions in mRNA decapping and interacts with both the decapping and deadenylase complexes. Coller JM, Tucker M, Sheth U, Valencia-Sanchez MA, Parker R RNA 2001-12-01 (7) 11780629
The DEAD box protein Dhh1 stimulates the decapping enzyme Dcp1. Fischer N, Weis K EMBO J 2002-06-03 (21) 12032091
Interaction between Not1p, a component of the Ccr4-not complex, a global regulator of transcription, and Dhh1p, a putative RNA helicase. Maillet L, Collart MA J Biol Chem 2002-02-25 (277) 11696541
Functional conservation of Dhh1p, a cytoplasmic DExD/H-box protein present in large complexes. Tseng-Rogenski SS, Chong JL, Thomas CB, Enomoto S, Berman J, Chang TH Nucleic Acids Res 2003-09-01 (31) 12930949
Decapping and decay of messenger RNA occur in cytoplasmic processing bodies. Sheth U, Parker R Science 2003-05-02 (300) 12730603
Processing bodies require RNA for assembly and contain nontranslating mRNAs. Teixeira D, Sheth U, Valencia-Sanchez MA, Brengues M, Parker R RNA 2005-04-01 (11) 15703442
The yeast EDC1 mRNA undergoes deadenylation-independent decapping stimulated by Not2p, Not4p, and Not5p. Muhlrad D, Parker R EMBO J 2005-03-09 (24) 15706350
Crystal structure and functional analysis of DEAD-box protein Dhh1p. Cheng Z, Coller J, Parker R, Song H RNA 2005-08-01 (11) 15987810



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.