Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

DNA topoisomerase 2-associated protein PAT1

 
Known also as: Decapping activator and translational repressor PAT1, Topoisomerase II-associated protein PAT1, mRNA turnover protein 1

Known abbreviations: PAT1, MRT1, YCR077C, YCR77C

 

FUNCTION:
 
Activator of decapping that functions as a general and active mechanism of translational repression and required for P-body formation. First decay factor recruited to mRNA, at a time when the mRNA is still associated with translation factors. Subsequently, PAT1 recruits the hepta-heterodimer LSM1-LSM7 complex to P-bodies. In association with the LSM1-LSM7 complex, stabilizes the 3' terminus of mRNAs. This association is also required for mosaic virus genomic RNA translation. Modulates the rates of mRNA-decapping that occur following deadenylation. Might be required for promoting the formation or the stabilization of the preinitiation translation complexes. Required for 40S ribosomal subunit joining to capped and/or polyadenylated mRNA. With other P-body components, enhances the formation of retrotransposition-competent Ty1 virus-like particles. Necessary for accurate chromosome transmission during cell division. 
 
SUBUNIT STRUCTURE:
 
Associates with the 40S ribosomal subunit. Associates with the heptameric LSM1-LSM7 complex. Interacts with DHH1, LSM1, LSM5, RPB4, RPB7 and with topoisomerase TOP2. Interacts with CDC33, PAB1, TIF4631 and TIF4632 in a RNA-dependent manner. Binds mRNAs. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm. Nucleus. Cytoplasm › P-body 
 
DOMAIN:
 
The region at residues 254 to 422 is required for stimulation of decapping. The region at residues 422 to 763 is required for PAT1 and LSM1 to accumulate in P-bodies and responsible for translation repression and P-body assembly. 



Activities in which DNA topoisomerase 2-associated protein PAT1 is involved: Pathways in which DNA topoisomerase 2-associated protein PAT1 is involved:

NCBI GI number(s): 330443486
330443485
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P25644 P25644
BRENDA - -
KEGG sce:YCR077C sce:YCR077C
PFAM: PF09770
PF09770
InterPro: IPR019167
IPR019167
CATH: - -
SCOP: - -


Protein sequence:
MSFFGLENSGNARDGPLDFEESYKGYGEHELEENDYLNDETFGDNVQVGT
DFDFGNPHSSGSSGNAIGGNGVGATARSYVAATAEGISGPRTDGTAAAGP
LDLKPMESLWSTAPPPAMAPSPQSTMAPAPAPQQMAPLQPILSMQDLERQ
QRQMQQQFMNFHAMGHPQGLPQGPPQQQFPMQPASGQPGPSQFAPPPPPP
GVNVNMNQMPMGPVQVPVQASPSPIGMSNTPSPGPVVGATKMPLQSGRRS
KRDLSPEEQRRLQIRHAKVEKILKYSGLMTPRDKDFITRYQLSQIVTEDP
YNEDFYFQVYKIIQRGGITSESNKGLIARAYLEHSGHRLGGRYKRTDIAL
QRMQSQVEKAVTVAKERPSKLKDQQAAAGNSSQDNKQANTVLGKISSTLN
SKNPRRQLQIPRQQPSDPDALKDVTDSLTNVDLASSGSSSTGSSAAAVAS
KQRRRSSYAFNNGNGATNLNKSGGKKFILELIETVYEEILDLEANLRNGQ
QTDSTAMWEALHIDDSSYDVNPFISMLSFDKGIKIMPRIFNFLDKQQKLK
ILQKIFNELSHLQIIILSSYKTTPKPTLTQLKKVDLFQMIILKIIVSFLS
NNSNFIEIMGLLLQLIRNNNVSFLTTSKIGLNLITILISRAALIKQDSSR
SNILSSPEISTWNEIYDKLFTSLESKIQLIFPPREYNDHIMRLQNDKFMD
EAYIWQFLASLALSGKLNHQRIIIDEVRDEIFATINEAETLQKKEKELSV
LPQRSQELDTELKSIIYNKEKLYQDLNLFLNVMGLVYRDGEISELK

DNA topoisomerase 2-associated protein PAT1 (Saccharomyces cerevisiae) is product of expression of PAT1 gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.