Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Scavenger mRNA-decapping enzyme DcpS

 
Known also as: DCS-1, Hint-related 7meGMP-directed hydrolase, Histidine triad protein member 5

Known abbreviations: DCPS, DCS1, HINT5, HSPC015

 

FUNCTION:
 
Necessary for the complete degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA fragments shorter than 10 nucleotides that are produced by 3'->5' exosome-mediated mRNA decay. Releases m7GMP. Can also degrade m7GDP to m7GMP. Has no activity towards mRNA molecules longer than 25 nucleotides. 
 
SUBUNIT STRUCTURE:
 
Homodimer. Associates with components of the exosome multienzyme ribonuclease complex, such as EXOSC3 and EXOSC4.
 
CELLULAR LOCALIZATION:
 
Cytoplasm. Nucleus
 
TISSUE SPECIFICITY:
 
Detected in liver, brain, kidney, testis and prostate. 

 




Activities in which Scavenger mRNA-decapping enzyme DcpS is involved: Pathways in which Scavenger mRNA-decapping enzyme DcpS is involved:

NCBI GI number(s): 7661734
37537717
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q96C86 Q96C86
BRENDA - -
KEGG hsa:2896 hsa:2896
PFAM: PF05652
PF05652
InterPro: IPR011146
IPR019808
IPR008594
IPR011145
IPR011146
IPR019808
IPR008594
IPR011145
CATH: - -
SCOP: - -
Solved crystal structures: 3BLA
3BL9
3BL7
1XMM
1XML
1ST4
1ST0
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQ
KVLRESARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVAQLLTG
SPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRL
IRETGDDYRNITLPHLESQSLSIQWVYNILDKKAEADRIVFENPDPSDGF
VLIPDLKWNQQQLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILHQGQE
AILQRYRMKGDHLRVYLHYLPSYYHLHVHFTALGFEAPGSGVERAHLLAE
VIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQS

Scavenger mRNA-decapping enzyme DcpS (Homo sapiens) is product of expression of DCPS gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Insights into the structure, mechanism, and regulation of scavenger mRNA decapping activity. Gu M, Fabrega C, Liu SW, Liu H, Kiledjian M, Lima CD Mol Cell 2004-04-09 (14) 15068804
The scavenger mRNA decapping enzyme DcpS is a member of the HIT family of pyrophosphatases. Liu H, Rodgers ND, Jiao X, Kiledjian M EMBO J 2002-09-02 (21) 12198172
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem 2009-06-01 (81) 19413330
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Lysine acetylation targets protein complexes and co-regulates major cellular functions. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M Science 2009-08-14 (325) 19608861
Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z Genome Res 2000-10-01 (10) 11042152
Coordinate expression of NADPH-dependent flavin reductase, Fre-1, and Hint-related 7meGMP-directed hydrolase, DCS-1. Kwasnicka DA, Krakowiak A, Thacker C, Brenner C, Vincent SR J Biol Chem 2003-10-03 (278) 12871939
Functional link between the mammalian exosome and mRNA decapping. Wang Z, Kiledjian M Cell 2001-12-14 (107) 11747811
DcpS can act in the 5'-3' mRNA decay pathway in addition to the 3'-5' pathway. van Dijk E, Le Hir H, Seraphin B Proc Natl Acad Sci U S A 2003-10-14 (100) 14523240
Functional analysis of mRNA scavenger decapping enzymes. Liu SW, Jiao X, Liu H, Gu M, Lima CD, Kiledjian M RNA 2004-09-01 (10) 15273322



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.