Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Pinin

 
Known also as: 140 kDa nuclear and cell adhesion-related phosphoprotein,Desmosome-associated protein,Domain-rich serine protein,Melanoma metastasis clone A protein,Nuclear protein SDK3,SR-like protein

Known abbreviations: PNN, DRS, MEMA, DRS protein, DRSP

 

FUNCTION:
 
Transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. Capable of reversing CTBP1-mediated transcription repression. Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Participates in the regulation of alternative pre-mRNA splicing. Associates to spliced mRNA within 60 nt upstream of the 5'-splice sites. Involved in the establishment and maintenance of epithelia cell-cell adhesion. Potential tumor suppressor for renal cell carcinoma. 
 
SUBUNIT STRUCTURE:
 
Found in a mRNA splicing-dependent exon junction complex (EJC), at least composed of ACIN1, CASC3, EIF4A3, MAGOH, PNN, RBM8A, RNPS1, SAP18 and ALYREF/THOC4. Found in a complex with SR proteins. Found in a mRNP complex with RNPS1. Interacts with C6orf111/SRRP130, CTBP1, CTBP2, KRT8, KRT18, KRT19, PS1D/PNO40, PPIG, RNPS1, SFRS4 and SRRM2. Identified in the spliceosome C complex. 
 
CELLULAR LOCALIZATION:
 
Nucleus speckle. Cell junction › desmosome. Note: Cell-cell contact area, predominantly desmosome of intercellular adherens junction. Not a nucleocytoplasmic shuttling protein.
 
TISSUE SPECIFICITY:
 
Expressed in placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, epidermis, esophagus, brain and smooth and skeletal muscle. Expressed strongly in melanoma metastasis lesions and advanced primary tumors. 
 
POST-TRANSLATIONAL MODIFICATION:
 
Phosphorylated upon DNA damage, probably by ATM or ATR.



This protein can be a part of a given complexes: Activities in which Pinin is involved: Pathways in which Pinin is involved:

NCBI GI number(s): 33356174
133908618
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9H307 Q9H307
BRENDA - -
KEGG hsa:5411 hsa:5411
PFAM: PF04696
PF04697
PF04696
PF04697
InterPro: IPR006786
IPR006787
IPR006786
IPR006787
CATH: - -
SCOP: - -


Protein sequence:
MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP
GGGRGRGSLLLRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQES
DPEDDDVKKPALQSSVVATSKERTRRDLIQDQNMDEKGKQRNRRIFGLLM
GTLQKFKQESTVATERQKRRQEIEQKLEVQAEEERKQVENERRELFEERR
AKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCP
ATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN
EEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAE
KEQEEEEQKQEMEVKMEEETEVRESEKQQDSQPEEVMDVLEMVENVKHVI
ADQEVMETNRVESVEPSENEASKELEPEMEFEIEPDKECKSLSPGKENVS
ALDMEKESEEKEEKESEPQPEPVAQPQPQSQPQLQLQSQSQPVLQSQPPS
QPEDLSLAVLQPTPQVTQEQGHLLPERKDFPVESVKLTEVPVEPVLTVHP
ESKSKTKTRSRSRGRARNKTSKSRSRSSSSSSSSSSSTSSSSGSSSSSGS
SSSRSSSSSSSSTSGSSSRDSSSSTSSSSESRSRSRGRGHNRDRKHRRSV
DRKRRDTSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKR
SSRSERDRKSDRKDKRR

Pinin (Homo sapiens) is product of expression of PNN gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis. Jurica MS, Licklider LJ, Gygi SR, Grigorieff N, Moore MJ RNA 2002-04-01 (8) 11991638
Characterization of pinin, a novel protein associated with the desmosome-intermediate filament complex. Ouyang P, Sugrue SP J Cell Biol 1996-11-01 (135) 8922384
A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP Nat Biotechnol 2006-10-01 (24) 16964243
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M Cell 2006-11-03 (127) 17081983
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem 2009-06-01 (81) 19413330
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ Science 2007-05-25 (316) 17525332
Lysine acetylation targets protein complexes and co-regulates major cellular functions. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M Science 2009-08-14 (325) 19608861
A quantitative atlas of mitotic phosphorylation. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP Proc Natl Acad Sci U S A 2008-08-05 (105) 18669648
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK Sci Signal 2009-01-01 (2) 19690332
Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M Mol Cell 2008-08-08 (31) 18691976
Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core. Tange TO, Shibuya T, Jurica MS, Moore MJ RNA 2005-12-01 (11) 16314458
Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A Proc Natl Acad Sci U S A 2007-01-13 (104) 17287340
Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Wang B, Malik R, Nigg EA, Korner R Anal Chem 2008-12-15 (80) 19007248
Nuclear Pnn/DRS protein binds to spliced mRNPs and participates in mRNA processing and export via interaction with RNPS1. Li C, Lin RI, Lai MC, Ouyang P, Tarn WY Mol Cell Biol 2003-10-01 (23) 14517304
Human RNPS1 and its associated factors: a versatile alternative pre-mRNA splicing regulator in vivo. Sakashita E, Tatsumi S, Werner D, Endo H, Mayeda A Mol Cell Biol 2004-01-01 (24) 14729963
memA/DRS, a putative mediator of multiprotein complexes, is overexpressed in the metastasizing human melanoma cell lines BLM and MV3. Degen WG, Agterbos MA, Muyrers JP, Bloemers HP, Swart GW Biochim Biophys Acta 1999-03-19 (1444) 10095061
Characterization of the gene encoding pinin/DRS/memA and evidence for its potential tumor suppressor function. Shi Y, Ouyang P, Sugrue SP Oncogene 2000-02-13 (19) 10645008
Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL Proc Natl Acad Sci U S A 2000-08-15 (97) 10931946
Evidence that "pinin", reportedly a differentiation-specific desmosomal protein, is actually a widespread nuclear protein. Brandner JM, Reidenbach S, Franke WW Differentiation 1997-12-01 (62) 9447706
Antibodies differentiate desmosome-form and nucleus-form pinin: evidence that pinin is a moonlighting protein with dual location at the desmosome and within the nucleus. Ouyang P Biochem Biophys Res Commun 1999-09-16 (263) 10486276
Dissection of protein linkage between keratins and pinin, a protein with dual location at desmosome-intermediate filament complex and in the nucleus. Shi J, Sugrue SP J Biol Chem 2000-05-19 (275) 10809736
Modulation of alternative pre-mRNA splicing in vivo by pinin. Wang P, Lou PJ, Leu S, Ouyang P Biochem Biophys Res Commun 2002-06-07 (294) 12051732
Molecular characterization of a novel nucleolar protein, pNO40. Chang WL, Lee DC, Leu S, Huang YM, Lu MC, Ouyang P Biochem Biophys Res Commun 2003-08-01 (307) 12893261
Pinin/DRS/memA interacts with SRp75, SRm300 and SRrp130 in corneal epithelial cells. Zimowska G, Shi J, Munguba G, Jackson MR, Alpatov R, Simmons MN, Shi Y, Sugrue SP Invest Ophthalmol Vis Sci 2003-11-01 (44) 14578391
Over-expression of SR-cyclophilin, an interaction partner of nuclear pinin, releases SR family splicing factors from nuclear speckles. Lin CL, Leu S, Lu MC, Ouyang P Biochem Biophys Res Commun 2004-08-27 (321) 15358154
Nuclear speckle-associated protein Pnn/DRS binds to the transcriptional corepressor CtBP and relieves CtBP-mediated repression of the E-cadherin gene. Alpatov R, Munguba GC, Caton P, Joo JH, Shi Y, Shi Y, Hunt ME, Sugrue SP Mol Cell Biol 2004-12-01 (24) 15542832
Reduction of Pnn by RNAi induces loss of cell-cell adhesion between human corneal epithelial cells. Joo JH, Alpatov R, Munguba GC, Jackson MR, Hunt ME, Sugrue SP Mol Vis 2005-01-18 (11) 15735603
Phosphoproteome analysis of the human mitotic spindle. Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R Proc Natl Acad Sci U S A 2006-04-04 (103) 16565220



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.