|
Known abbreviations: ACIN1, ACINUS, KIAA0670
FUNCTION:
Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Induces apoptotic chromatin condensation after activation by CASP3. Regulates cyclin A1, but not cyclin A2, expression in leukemia cells.
SUBUNIT STRUCTURE:
Found in a mRNA splicing-dependent exon junction complex (EJC), at least composed of ACIN1, CASC3, EIF4A3, MAGOH, PNN, RBM8A, RNPS1, SAP18 and ALYREF/THOC4. Forms heterodimers with RNPS1. Found in a heterotrimeric complex with ACIN1, RNPS1 and SAP18. Interacts with API5. Interacts with SRPK2 in a phosphorylation-dependent manner.
CELLULAR LOCALIZATION:
Nucleus. Nucleus speckle. Nucleus › nucleoplasm. Note: Phosphorylation on Ser-1180 by SRPK2 redistributes it from the nuclear speckles to the nucleoplasm.
TISSUE SPECIFICITY:
Ubiquitous. The Ser-1180 phosphorylated form (by SRPK2) is highly expressed and phosphorylated in patients with myeloid hematologic malignancies.
POST-TRANSLATIONAL MODIFICATION:
Phosphorylation on Ser-1180 by SRPK2 up-regulates its stimulatory effect on cyclin A1.
Undergoes proteolytic cleavage; the processed form is active, contrary to the uncleaved form.
|
This protein can be a part of a given complexes:
Activities in which Apoptotic chromatin condensation inducer in the nucleus is involved:
Pathways in which Apoptotic chromatin condensation inducer in the nucleus is involved:
Links to other databases:
Protein sequence:
MWRRKHPRTSGGTRGVLSGNRGVEYGSGRGHLGTFEGRWRKLPKMPEAVG
TDPSTSRKMAELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVK
RLKGALMLENLQKHSTPHAAFQPNSQIGEEMSQNSFIKQYLEKQQELLRQ
RLEREAREAAELEEASAESEDEMIHPEGVASLLPPDFQSSLERPELELSR
HSPRKSSSISEEKGDSDDEKPRKGERRSSRVRQARAAKLSEGSQPAEEEE
DQETPSRNLRVRADRNLKTEEEEEEEEEEEEDDEEEEGDDEGQKSREAPI
LKEFKEEGEEIPRVKPEEMMDERPKTRSQEQEVLERGGRFTRSQEEARKS
HLARQQQEKEMKTTSPLEEEEREIKSSQGLKEKSKSPSPPRLTEDRKKAS
LVALPEQTASEEETPPPLLTKEASSPPPHPQLHSEEEIEPMEGPAPAVLI
QLSPPNTDADTRELLVSQHTVQLVGGLSPLSSPSDTKAESPAEKVPEESV
LPLVQKSTLADYSAQKDLEPESDRSAQPLPLKIEELALAKGITEECLKQP
SLEQKEGRRASHTLLPSHRLKQSADSSSSRSSSSSSSSSRSRSRSPDSSG
SRSHSPLRSKQRDVAQARTHANPRGRPKMGSRSTSESRSRSRSRSRSASS
NSRKSLSPGVSRDSSTSYTETKDPSSGQEVATPPVPQLQVCEPKERTSTS
SSSVQARRLSQPESAEKHVTQRLQPERGSPKKCEAEEAEPPAATQPQTSE
TQTSHLPESERIHHTVEEKEEVTMDTSENRPENDVPEPPMPIADQVSNDD
RPEGSVEDEEKKESSLPKSFKRKISVVSATKGVPAGNSDTEGGQPGRKRR
WGASTATTQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDSRISED
ETERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEEKEPEAEPPV
PPQVSVEVALPPPAEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTA
QVPSPPRGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKS
HCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDELDYHRGLLV
DRPSETKTEEQGIPRPLHPPPPPPVQPPQHPRAEQREQERAVREQWAERE
REMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKE
KAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREK
RRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERERERDRG
DRDRDRERDRERGRERDRRDTKRHSRSRSRSTPVRDRGGRR
|
Apoptotic chromatin condensation inducer in the nucleus (Homo sapiens) is product of expression of
ACIN1
gene.
References:
Title |
Authors |
Journal
| Publication date (Issue)
| PubMed ID
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K |
Genome Res
|
2004-10-01 (14) |
15489334 |
Acinus is a caspase-3-activated protein required for apoptotic chromatin condensation. |
Sahara S, Aoto M, Eguchi Y, Imamoto N, Yoneda Y, Tsujimoto Y |
Nature
|
1999-09-09 (401) |
10490026 |
A probability-based approach for high-throughput protein phosphorylation analysis and site localization. |
Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP |
Nat Biotechnol
|
2006-10-01 (24) |
16964243 |
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. |
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M |
Cell
|
2006-11-03 (127) |
17081983 |
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. |
Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S |
Anal Chem
|
2009-06-01 (81) |
19413330 |
Initial characterization of the human central proteome. |
Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J |
BMC Syst Biol
|
2011-01-01 (5) |
21269460 |
The full-ORF clone resource of the German cDNA Consortium. |
Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I |
BMC Genomics
|
2007-01-01 (8) |
17974005 |
Lysine acetylation targets protein complexes and co-regulates major cellular functions. |
Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M |
Science
|
2009-08-14 (325) |
19608861 |
A quantitative atlas of mitotic phosphorylation. |
Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP |
Proc Natl Acad Sci U S A
|
2008-08-05 (105) |
18669648 |
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. |
Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK |
Sci Signal
|
2009-01-01 (2) |
19690332 |
Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. |
Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd |
J Proteome Res
|
2008-03-01 (7) |
18220336 |
Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core. |
Tange TO, Shibuya T, Jurica MS, Moore MJ |
RNA
|
2005-12-01 (11) |
16314458 |
The DNA sequence and analysis of human chromosome 14. |
Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A |
Nature
|
2003-01-06 (421) |
12508121 |
Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. |
Ishikawa K, Nagase T, Suyama M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O |
DNA Res
|
1998-06-01 (5) |
9734811 |
Large-scale characterization of HeLa cell nuclear phosphoproteins. |
Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP |
Proc Natl Acad Sci U S A
|
2004-08-17 (101) |
15302935 |
Global phosphoproteome of HT-29 human colon adenocarcinoma cells. |
Kim JE, Tannenbaum SR, White FM |
J Proteome Res
|
2005-01-01 (4) |
16083285 |
Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. |
Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD |
J Proteome Res
|
2007-11-01 (6) |
17924679 |
Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. |
Molina H, Horn DM, Tang N, Mathivanan S, Pandey A |
Proc Natl Acad Sci U S A
|
2007-01-13 (104) |
17287340 |
Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry. |
Denis NJ, Vasilescu J, Lambert JP, Smith JC, Figeys D |
Proteomics
|
2007-03-01 (7) |
17370265 |
Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. |
Wang B, Malik R, Nigg EA, Korner R |
Anal Chem
|
2008-12-15 (80) |
19007248 |
Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. |
Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y |
Anal Sci
|
2008-02-01 (24) |
18187866 |
Serine/arginine protein-specific kinase 2 promotes leukemia cell proliferation by phosphorylating acinus and regulating cyclin A1. |
Jang SW, Yang SJ, Ehlen A, Dong S, Khoury H, Chen J, Persson JL, Ye K |
Cancer Res
|
2008-06-15 (68) |
18559500 |
Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. |
Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J |
J Proteome Res
|
2008-12-01 (7) |
19367720 |
Protein lysine methyltransferase G9a acts on non-histone targets. |
Rathert P, Dhayalan A, Murakami M, Zhang X, Tamas R, Jurkowska R, Komatsu Y, Shinkai Y, Cheng X, Jeltsch A |
Nat Chem Biol
|
2008-06-01 (4) |
18438403 |
Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography. |
Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J |
Proteomics
|
2008-04-01 (8) |
18318008 |
The antiapoptotic protein AAC-11 interacts with and regulates Acinus-mediated DNA fragmentation. |
Rigou P, Piddubnyak V, Faye A, Rain JC, Michel L, Calvo F, Poyet JL |
EMBO J
|
2009-06-03 (28) |
19387494 |
The consensus coding sequences of human breast and colorectal cancers. |
Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE |
Science
|
2006-10-13 (314) |
16959974 |
Add your own comment!
There are no comments yet.
Last modification of this entry: Sept. 25, 2012.
|