Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Histone deacetylase complex subunit SAP18

 
Known also as: 18 kDa Sin3-associated polypeptide,2HOR0202,Cell growth-inhibiting gene 38 protein,Sin3-associated polypeptide p18,

Known abbreviations: SAP18, GIG38

 

FUNCTION:
 
Component of the SIN3-repressing complex. Enhances the ability of SIN3-HDAC1-mediated transcriptional repression. When tethered to the promoter, it can direct the formation of a repressive complex to core histone proteins. Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. 
 
SUBUNIT STRUCTURE:
 
Found in a mRNA splicing-dependent exon junction complex (EJC), at least composed of ACIN1, CASC3, EIF4A3, MAGOH, PNN, RBM8A, RNPS1, SAP18 and ALYREF/THOC4. Found in a heterotrimeric complex with ACIN1, RNPS1 and SAP18. Forms a complex with SIN3A and HDAC1.
 
CELLULAR LOCALIZATION:
 
Nucleus. Cytoplasm. Note: Shuttles between the nucleus and the cytoplasm. 
 
TISSUE SPECIFICITY:
 
Ubiquitous.
 



This protein can be a part of a given complexes: Activities in which Histone deacetylase complex subunit SAP18 is involved: Pathways in which Histone deacetylase complex subunit SAP18 is involved:

NCBI GI number(s): 215490089
215490088
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot O00422 O00422
BRENDA - -
KEGG hsa:10284 hsa:10284
PFAM: PF06487
PF06487
InterPro: IPR017250
IPR010516
IPR017250
IPR010516
CATH: - -
SCOP: - -
Solved crystal structures: 2HDE
[PDB] [details]


Protein sequence:
MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGN
VPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPG
YRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRM
RPY

Histone deacetylase complex subunit SAP18 (Homo sapiens) is product of expression of SAP18 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex. Zhang Y, Iratni R, Erdjument-Bromage H, Tempst P, Reinberg D Cell 1997-05-02 (89) 9150135
The DNA sequence and analysis of human chromosome 13. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S Nature 2004-04-01 (428) 15057823
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem 2009-06-01 (81) 19413330
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core. Tange TO, Shibuya T, Jurica MS, Moore MJ RNA 2005-12-01 (11) 16314458



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.