Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Regulator of nonsense transcripts 2

 
Known also as: Nonsense mRNA reducing factor 2, Up-frameshift suppressor 2 homolog

Known abbreviations: hUpf2, UPF2, KIAA1408, RENT2

 

FUNCTION:
 
Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC). Recruited by UPF3B associated with the EJC core at the cytoplasmic side of the nuclear envelope and the subsequent formation of an UPF1-UPF2-UPF3 surveillance complex (including UPF1 bound to release factors at the stalled ribosome) is believed to activate NMD. In cooperation with UPF3B stimulates both ATPase and RNA helicase activities of UPF1. Binds spliced mRNA. 
 
SUBUNIT STRUCTURE:
 
Found in a post-splicing messenger ribonucleoprotein (mRNP) complex. Associates with the exon junction complex (EJC). Interacts with SMG1, EST1A, UPF1, UPF3A, UPF3B, EIF4A1 and EIF1. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm › perinuclear region.
 
TISSUE SPECIFICITY:
 
Ubiquitous.



Activities in which Regulator of nonsense transcripts 2 is involved: Pathways in which Regulator of nonsense transcripts 2 is involved:

NCBI GI number(s): 11693132
359751385
18375676
359751384
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9HAU5 Q9HAU5
BRENDA - -
KEGG hsa:26019 hsa:26019
PFAM: PF02854
PF04050
PF02854
PF04050
InterPro: IPR016024
IPR016021
IPR003890
IPR007193
IPR016024
IPR016021
IPR003890
IPR007193
CATH: - -
SCOP: - -
Solved crystal structures: 2WJV
1UW4
[PDB] [details]
[PDB] [details]


Protein sequence:
MPAERKKPASMEEKDSLPNNKEKDCSERRTVSSKERPKDDIKLTAKKEVS
KAPEDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEE
ERKKQEEQAKRQQEEEAAAQMKEKEESIQLHQEAWERHHLRKELRSKNQN
APDSRPEENFFSRLDSSLKKNTAFVKKLKTITEQQRDSLSHDFNGLNLSK
YIAEAVASIVEAKLKISDVNCAVHLCSLFHQRYADFAPSLLQVWKKHFEA
RKEEKTPNITKLRTDLRFIAELTIVGIFTDKEGLSLIYEQLKNIINADRE
SHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPSEIISPEKQQ
PFQNLLKEYFTSLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYE
EFAMSYQKLLANSQSLADLLDENMPDLPQDKPTPEEHGPGIDIFTPGKPG
EYDLEGGIWEDEDARNFYENLIDLKAFVPAILFKDNEKSCQNKESNKDDT
KEAKESKENKEVSSPDDLELELENLEINDDTLELEGGDEAEDLTKKLLDE
QEQEDEEASTGSHLKLIVDAFLQQLPNCVNRDLIDKAAMDFCMNMNTKAN
RKKLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSMLRGDFRF
HVRKKDQINIETKNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFSHHHI
EMACTLLETCGRFLFRSPESHLRTSVLLEQMMRKKQAMHLDARYVTMVEN
AYYYCNPPPAEKTVKKKRPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPW
QDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVL
EDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFG
VNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQ
RYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQV
QDLEREFLIKLGLVNDKDSKDSMTEGENLEEDEEEEEGGAETEEQSGNES
EVNEPEEEEGSDNDDDEGEEEEEENTDYLTDSNKENETDEENTEVMIKGG
GLKHVPCVEDEDFIQALDKMMLENLQQRSGESVKVHQLDVAIPLHLKSQL
RKGPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWN
QQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRP
RYQHPKGAPNADLIFKTGGRRR

Regulator of nonsense transcripts 2 (Homo sapiens) is product of expression of UPF2 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Characterization of human Smg5/7a: a protein with similarities to Caenorhabditis elegans SMG5 and SMG7 that functions in the dephosphorylation of Upf1. Chiu SY, Serin G, Ohara O, Maquat LE RNA 2003-02-01 (9) 12554878
Human Upf proteins target an mRNA for nonsense-mediated decay when bound downstream of a termination codon. Lykke-Andersen J, Shu MD, Steitz JA Cell 2000-12-22 (103) 11163187
Human SMG-1, a novel phosphatidylinositol 3-kinase-related protein kinase, associates with components of the mRNA surveillance complex and is involved in the regulation of nonsense-mediated mRNA decay Yamashita A, Ohnishi T, Kashima I, Taya Y, Ohno S Genes Dev 2001-09-01 (15) 11544179
Exon-junction complex components specify distinct routes of nonsense-mediated mRNA decay with differential cofactor requirements. Gehring NH, Kunz JB, Neu-Yilik G, Breit S, Viegas MH, Hentze MW, Kulozik AE Mol Cell 2005-10-07 (20) 16209946
Communication of the position of exon-exon junctions to the mRNA surveillance machinery by the protein RNPS1. Lykke-Andersen J, Shu MD, Steitz JA Science 2001-09-07 (293) 11546874
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem 2009-06-01 (81) 19413330
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
The full-ORF clone resource of the German cDNA Consortium. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I BMC Genomics 2007-01-01 (8) 17974005
Novel Upf2p orthologues suggest a functional link between translation initiation and nonsense surveillance complexes. Mendell JT, Medghalchi SM, Lake RG, Noensie EN, Dietz HC Mol Cell Biol 2000-12-01 (20) 11073994
Identification and characterization of human orthologues to Saccharomyces cerevisiae Upf2 protein and Upf3 protein (Caenorhabditis elegans SMG-4). Serin G, Gersappe A, Black JD, Aronoff R, Maquat LE Mol Cell Biol 2001-02-01 (21) 11113196
Binding of a novel SMG-1-Upf1-eRF1-eRF3 complex (SURF) to the exon junction complex triggers Upf1 phosphorylation and nonsense-mediated mRNA decay. Kashima I, Yamashita A, Izumi N, Kataoka N, Morishita R, Hoshino S, Ohno M, Dreyfuss G, Ohno S Genes Dev 2006-01-01 (20) 16452507
Unusual bipartite mode of interaction between the nonsense-mediated decay factors, UPF1 and UPF2. Clerici M, Mourao A, Gutsche I, Gehring NH, Hentze MW, Kulozik A, Kadlec J, Sattler M, Cusack S EMBO J 2009-08-05 (28) 19556969
Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O DNA Res 2000-01-28 (7) 10718198
The DNA sequence and analysis of human chromosome 6. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE Nature 2003-10-23 (425) 14574404
NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity. Chamieh H, Ballut L, Bonneau F, Le Hir H Nat Struct Mol Biol 2008-02-01 (15) 18066079
The structural basis for the interaction between nonsense-mediated mRNA decay factors UPF2 and UPF3. Kadlec J, Izaurralde E, Cusack S Nat Struct Mol Biol 2004-04-01 (11) 15004547



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.