Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Eukaryotic peptide chain release factor subunit 1

 
Known also as: Eukaryotic release factor 1

Known abbreviations: eRF1, ETF1, ERF1, RF1, SUP45L1, Protein Cl1, TB3-1

 

FUNCTION:
 
Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. 
 
SUBUNIT STRUCTURE:
 
Heterodimer of two subunits, one of which binds GTP. Component of the transient SURF (SMG1-UPF1-eRF1-eRF3) complex.
 
CELLULAR LOCALIZATION:
 
Cytoplasm.



This protein can be a part of a given complexes: Activities in which Eukaryotic peptide chain release factor subunit 1 is involved: Pathways in which Eukaryotic peptide chain release factor subunit 1 is involved:

NCBI GI number(s): 4759034
372626411
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot P62495 P62495
BRENDA - -
KEGG hsa:2107 hsa:2107
PFAM: PF03463
PF03464
PF03465
PF03463
PF03464
PF03465
InterPro: IPR005140
IPR005141
IPR005142
IPR004403
IPR024049
IPR005140
IPR005141
IPR005142
IPR004403
IPR024049
CATH: - -
SCOP: - -
Solved crystal structures: 3E1Y
2LGT
2KTV
2KTU
2HST
1DT9
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAK
MLADEFGTASNIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTI
VTEEGKEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALLSDDSKFGFIV
IDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHN
YVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKV
LKLVDISYGGENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGK
YCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQ
EKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGS
QFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY

Eukaryotic peptide chain release factor subunit 1 (Homo sapiens) is product of expression of ETF1 gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.