Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Eukaryotic peptide chain release factor GTP-binding subunit ERF3A

 
Known also as: G1 to S phase transition protein 1 homolog, Eukaryotic peptide chain release factor subunit 3a

Known abbreviations: eRF3a, GSPT1, ERF3A

 

FUNCTION:
Involved in translation termination in response to the termination codons UAA, UAG and UGA. Stimulates the activity of ERF1. Involved in regulation of mammalian cell growth. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.
 
SUBUNIT STRUCTURE:
 
Component of the transient SURF (SMG1-UPF1-eRF1-eRF3) complex.



This protein can be a part of a given complexes: Activities in which Eukaryotic peptide chain release factor GTP-binding subunit ERF3A is involved: Pathways in which Eukaryotic peptide chain release factor GTP-binding subunit ERF3A is involved:

NCBI GI number(s): 194097354
194097353
194018522
194018521
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot P15170 P15170
BRENDA - -
KEGG hsa:2935 hsa:2935
PFAM: PF00009
PF03144
PF03143
PF00009
PF03144
PF03143
InterPro: IPR000795. ProtSyn_GTP-bd. IPR009001. Transl_elong_EF1A/Init_IF2_C. IPR004161
. IPR004160. Transl_elong_EFTu/EF1A_C. IPR009000
IPR000795. ProtSyn_GTP-bd. IPR009001. Transl_elong_EF1A/Init_IF2_C. IPR004161
. IPR004160. Transl_elong_EFTu/EF1A_C. IPR009000
CATH: - -
SCOP: - -
Solved crystal structures: 3KUI
3E1Y
[PDB] [details]
[PDB] [details]


Protein sequence:
MELSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEM
MEEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGM
VDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETE
KKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQT
REHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGF
NPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDG
PIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDD
VETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVII
EHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQD
QVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD

Eukaryotic peptide chain release factor GTP-binding subunit ERF3A (Homo sapiens) is product of expression of GSPT1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay. Yamashita A, Izumi N, Kashima I, Ohnishi T, Saari B, Katsuhata Y, Muramatsu R, Morita T, Iwamatsu A, Hachiya T, Kurata R, Hirano H, Anderson P, Ohno S Genes Dev 2009-05-01 (23) 19417104
A human homologue of the yeast GST1 gene codes for a GTP-binding protein and is expressed in a proliferation-dependent manner in mammalian cells. Hoshino S, Miyazawa H, Enomoto T, Hanaoka F, Kikuchi Y, Kikuchi A, Ui M EMBO J 1989-12-01 (8) 2511002
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q. Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD Genomics 1999-09-15 (60) 10493829
Molecular basis of eRF3 recognition by the MLLE domain of poly(A)-binding protein. Kozlov G, Gehring K PLoS One 2010-01-01 (5) 20418951



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.